Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR272 IGR269 IGR271 IGR270 IGR273 IGR274 IGR268 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 rl28, - CPn0327 CPn0334 yojL, - CPn0336 CPn0329 dnaN, - CPn0338 malQ, - CPn0326 CPn0328 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 rl28, - CPn0327 CPn0334 yojL, - CPn0336 CPn0329 dnaN, - CPn0338 malQ, - CPn0326 CPn0328 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0332 yojL, - CPn0336 CPn0329 dnaN, - CPn0338 malQ, - CPn0326 CPn0328 folD, - CPn0335 folD, - CPn0335 CPn0334 rl28, - CPn0327
* Calculated from Protein Sequence

Gene ID: CPn0331

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
378437

Gene Stop:
376698

Gene Length:
1740

Molecular Weight*:
61048

pI*:
9.50

Net Charge*:
4.50

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0331 is similar to CT082, a predicted hypothetical protein. Residues 1-570 are 39% similar to CT082.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
70  
228
coil-coil  
291  
321
non-globular  
516  
579

PDB Hit:


Gene Protein Sequence:
MAVSGGGGVQPSSDPGKWNPALQGEQAEGPSPLKESIFSETKQASSAAKQ
ESLVRSGSTGMYATESQINKAKYRKAQDRSSTSPKSKLKGTFSKMRASVQ
GFMSGFGSRASRVSAKRASDSGEGTSLLPTEMDVALKKGNRISPEMQGFF
LDASGMGGSSSDISQLSLEALKSSAFSGARSLSLSSSESSSVASFGSFQK
AIEPMSEEKVNAWTVARLGGEMVSSLLDPNVETSSLVRRAMATGNEGMID
LSDLGQEEVSTAMTSPRAVEGKVKVSSSDSPEANPTGIPNSNTLERAEKE
AEKQESREQLSEDQMMLARAMAGLLTGAAPQEVLSNSVWSGPSTVFPPPK
FSGTLPTQRSGDKSKHKSPGIEKSTNHTNFSPLREGTVKSAEVKSLPHPE
SMYRFPKDSIVSREEPEAVVKESTAFKNPENSSQNFLPIAVESVFPKESG
TGGALGSDAVSSSYHFLAQRGVSLLAPLPRATDDYKEKLEAHKGPGGPPD
PLIYQYRNVAVEPPIVLRSPQPFSGSSRLSVQGKPEAASVHDDGGGGNSG
GFSGDQRRGSSGQKASRQEKKGKKLSTDI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGTTTCAGGTGGCGGAGGGGTTCAGCCTTCTTCGGATCCAGGAAA
GTGGAATCCTGCTCTGCAAGGAGAGCAGGCAGAAGGCCCGTCTCCGCTAA
AAGAATCTATATTTTCTGAAACCAAGCAGGCCTCCTCTGCTGCGAAGCAG
GAAAGCTTAGTGCGTTCAGGATCTACAGGAATGTATGCAACAGAATCTCA
GATAAATAAGGCTAAGTATCGTAAAGCTCAAGATCGATCATCAACCTCTC
CAAAATCCAAATTGAAAGGTACATTTTCTAAAATGCGCGCTAGTGTGCAA
GGATTCATGTCAGGATTCGGATCTCGGGCTTCGAGAGTGTCAGCAAAGCG
TGCTTCCGATAGTGGTGAGGGAACATCCTTATTGCCGACAGAGATGGATG
TTGCTCTAAAGAAGGGAAACCGTATTTCACCTGAAATGCAGGGATTTTTC
TTAGATGCTTCGGGTATGGGAGGGAGTTCCTCTGATATTTCTCAGCTTTC
TTTAGAGGCTTTGAAATCTTCAGCATTTTCAGGTGCCAGGAGTTTAAGTT
TAAGCTCTTCAGAATCTAGTTCCGTGGCTTCGTTTGGATCTTTCCAAAAG
GCCATAGAGCCTATGAGTGAGGAGAAGGTAAATGCTTGGACAGTGGCTCG
TTTAGGAGGGGAGATGGTCAGCTCTCTTCTCGATCCCAATGTTGAGACCT
CATCATTAGTGCGCAGGGCAATGGCAACAGGCAACGAAGGCATGATAGAT
CTTTCTGATTTAGGACAGGAAGAGGTCAGTACAGCCATGACATCTCCCAG
AGCAGTAGAAGGAAAAGTAAAGGTATCTTCTTCTGATTCTCCAGAAGCGA
ATCCAACAGGAATTCCAAATTCTAATACTTTAGAAAGGGCGGAAAAGGAA
GCAGAGAAACAAGAAAGTCGAGAGCAGTTGAGTGAGGATCAGATGATGCT
TGCACGTGCTATGGCTGGGCTTCTTACAGGGGCAGCGCCTCAAGAGGTAT
TGAGTAATTCTGTTTGGTCTGGTCCTTCTACAGTATTTCCTCCTCCCAAG
TTTTCAGGAACTTTACCCACCCAGAGATCGGGAGATAAATCAAAGCATAA
ATCTCCAGGAATAGAGAAGAGTACGAACCATACGAACTTTTCTCCTCTTC
GGGAAGGTACTGTGAAGAGTGCTGAGGTTAAAAGTTTGCCTCATCCAGAA
AGTATGTATCGTTTTCCTAAAGATAGCATCGTTTCCAGGGAGGAACCTGA
AGCCGTTGTTAAAGAATCTACGGCATTCAAAAATCCAGAGAATAGCAGTC
AAAACTTTCTCCCTATTGCTGTGGAGAGTGTTTTCCCTAAGGAAAGTGGT
ACGGGAGGGGCTTTAGGAAGTGATGCTGTGAGTTCCTCATATCATTTCCT
TGCGCAACGTGGAGTGTCTTTACTCGCTCCTCTACCTCGTGCTACTGATG
ACTATAAAGAGAAGCTCGAAGCTCATAAAGGTCCTGGAGGTCCTCCAGAT
CCTTTGATTTATCAGTATCGAAATGTTGCTGTTGAGCCGCCAATTGTTCT
CCGTTCTCCCCAGCCGTTTTCAGGATCTTCACGTCTATCGGTTCAAGGAA
AGCCTGAAGCTGCTTCAGTTCATGACGATGGTGGGGGGGGAAATAGTGGT
GGTTTTAGCGGAGATCAAAGAAGAGGATCTTCGGGCCAGAAAGCTTCCCG
TCAGGAAAAGAAGGGAAAAAAATTATCTACGGATATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy