Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR267 IGR272 IGR269 IGR271 IGR270 IGR273 IGR274 IGR268 IGR275 CPn0332 ltuB, - CPn0333 CPn0330 CPn0331 rl28, - CPn0327 folD, - CPn0335 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 CPn0332 ltuB, - CPn0333 CPn0330 CPn0331 rl28, - CPn0327 folD, - CPn0335 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 Type: tandem, Name:  - 4 ltuB, - CPn0333 CPn0330 CPn0331 CPn0332 rl28, - CPn0327 folD, - CPn0335 CPn0329 malQ, - CPn0326 CPn0328 sycE, - CPn0325 CPn0334 CPn0334 copN,sctW,lcrE, - CPn0324 sycE, - CPn0325
* Calculated from Protein Sequence

Gene ID: CPn0329

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible phospholipase D HKD-related)

Gene Start:
375088

Gene Stop:
376149

Gene Length:
1062

Molecular Weight*:
40340

pI*:
9.60

Net Charge*:
10.42

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0329 is orthologously related to CT084: residues 10-353 of CPn0329 are 40% similar to residues 10-361 of CT084, a predicted conserved hypothetical protein (possible phospholipase D HKD-related) from C. trachomatis.
CPn0329 is also similar to CT157, CT154, CT158, CT155, all conserved hypothetical proteins (possible phospholipase D HKD-related protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae (unlike C. trachomatis).

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
27

PDB Hit:


Gene Protein Sequence:
MNKRQKDKLKICVIISTLILVGIFARAPRGDTFKTFLKSEEAIIYSNQCN
EDMRKILCDAIEHADEEIFLRIYNLSEPKIQQSLTRQAQAKNKVTIYYQK
FKIPQILKQASNVTLVEQPPAGRKLMHQKALSIDKKDAWLGSANYTNLSL
RLDNNLILGMHSSELCDLIITNTSGDFSIKDQTGKYFVLPQDRKIAIQAV
LEKIQTAQKTIQVAMFALTHSEIIQALHQAKQRGIHVDIIIDRSHSKLTF
KQLRQLNINKDFVSINTAPCTLHHKFAVIDNKTLLAGSINWSKGRFSLND
ESLIILENLTKQQNQKLRMIWKDLAKHSEHPTVDDEEKEIIEKSLPVEEQ
EAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAAGACAAAAAGATAAATTAAAAATCTGTGTTATTATTAGCAC
GTTGATTTTAGTAGGAATTTTTGCAAGAGCTCCTCGTGGTGACACTTTTA
AGACTTTTTTAAAGTCTGAAGAAGCTATCATCTACTCAAATCAATGCAAT
GAGGACATGCGTAAAATTCTATGCGATGCTATAGAACACGCTGATGAAGA
GATCTTCCTACGTATTTATAACCTCTCAGAACCCAAGATCCAACAGAGTT
TAACTCGACAAGCTCAAGCAAAAAACAAAGTTACGATCTACTATCAAAAA
TTTAAAATTCCCCAAATCTTAAAGCAAGCCAGCAATGTAACTTTAGTCGA
GCAACCTCCAGCAGGGCGTAAACTGATGCATCAAAAAGCTCTTTCCATAG
ATAAGAAAGATGCTTGGCTAGGATCTGCGAACTACACCAATCTTTCTCTA
CGTTTAGATAATAATCTCATTCTAGGAATGCATAGCTCGGAGCTCTGTGA
TCTCATTATCACAAATACCTCTGGAGACTTTTCTATAAAGGATCAAACAG
GAAAGTATTTTGTTCTTCCTCAAGATCGTAAAATTGCAATACAAGCTGTA
CTCGAAAAAATCCAGACAGCTCAGAAAACCATCCAAGTTGCTATGTTTGC
TCTGACCCACTCGGAGATTATTCAAGCCTTACATCAAGCAAAACAACGAG
GAATCCATGTAGATATTATCATTGATAGAAGTCATAGCAAACTTACTTTT
AAGCAATTACGACAATTAAATATCAATAAAGACTTTGTTTCTATAAATAC
CGCACCCTGTACTCTTCACCATAAGTTTGCAGTTATAGATAATAAAACTC
TACTTGCAGGATCTATAAATTGGTCTAAAGGAAGATTCTCCTTAAATGAT
GAAAGCTTGATCATACTGGAAAACCTGACCAAACAACAAAATCAGAAACT
TCGAATGATTTGGAAAGATCTAGCTAAGCATTCAGAACATCCTACAGTAG
ACGATGAAGAAAAAGAAATTATAGAAAAAAGTCTTCCAGTAGAAGAGCAA
GAAGCAGCGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy