Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR267 IGR272 IGR269 IGR266 IGR271 IGR270 IGR273 IGR274 IGR268 IGR275 CPn0332 ltuB, - CPn0333 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 CPn0332 ltuB, - CPn0333 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 Type: tandem, Name:  - 4 ltuB, - CPn0333 CPn0330 CPn0331 CPn0332 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 sycE, - CPn0325 sycE, - CPn0325
* Calculated from Protein Sequence

Gene ID: CPn0328

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (with ACR)

Gene Start:
373241

Gene Stop:
374995

Gene Length:
1755

Molecular Weight*:
66497

pI*:
9.30

Net Charge*:
12.81

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0328 is orthologously related to CT085, a conserved hypothetical protein: residues 1-577 are 64% similar to CT085.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0043
COG name: Uncharacterized ACR, YigC family
Functional Class:  S
The phylogenetic pattern of COG0043 is Amtkyq-ceb--uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 421 (E-value = 9.3e-181) place CPn0328 in the UbiD family which is described as 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (PF01977)

PDB Hit:


Gene Protein Sequence:
MSFLRRHISLFRSQKQLIDVFAPVSPNLELAEIHRRVIEDQGPALLFHNV
IGSSFPVLTNLFGTKHRVDQLFSQAPDNLIARVAHLISSTPKLSSLWKSR
DLLKRISSLGLKKARFRRFPFVSMSSVNLDHLPLLTSWPEDGGAFLTLPL
VYTESPTLTTPNLGMYRVQRFNQNTMGLHFQIQKGGGMHLYEAEQKKQNL
PVSVFLSGNPFLTLSAIAPLPENVSELLFATFLQGAKLLYKKTNDHPHPL
LYDAEFILVGESPAGKRRPEGPFGDHFGYYSLQHDFPEFHCHKIYHRKDA
IYPATVVGKPYQEDFYIGNKLQEYLSPLFPLVMPGVRRLKSYGESGFHAL
TAAVVKERYWRESLTTALRILGEGQLSLTKFLMVTDQEVPLDRFSVVLET
ILERLQPDRDLIIFSETANDTLDYTGPSLNKGSKGIFMGIGKAIRDLPHG
YQGGKIHGVQDIAPFCRGCLVLETSLEDRCIKSLLHHPDLKSWPLIILAD
NLRETIQSEKDFLWRTFTRCAPANDLHALHSHFATHRPNYNFPFVIDALM
KPSYPKEVEVDPSTKQKVSERWHAYFPNKETFYI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTTCTTAAGGCGTCATATTTCTCTTTTTCGTTCACAAAAACAACT
TATTGATGTTTTTGCTCCCGTAAGTCCTAACCTCGAGTTAGCTGAGATTC
ATCGTCGTGTTATTGAAGATCAAGGCCCTGCCCTTCTTTTTCATAATGTC
ATCGGATCGTCATTCCCAGTCCTGACCAATCTCTTTGGAACAAAACATCG
TGTAGACCAACTTTTTTCTCAAGCTCCTGATAACCTCATCGCTCGAGTTG
CCCACCTTATTTCTTCTACACCAAAGCTTTCTTCTCTATGGAAATCTCGG
GATCTATTAAAAAGAATAAGCTCTTTAGGGCTCAAAAAAGCTCGATTCCG
TCGCTTTCCTTTTGTTTCTATGTCCTCAGTTAACTTAGATCACCTTCCCT
TACTCACAAGCTGGCCTGAAGATGGTGGAGCCTTTCTCACACTTCCTCTT
GTCTATACGGAATCGCCGACTCTTACTACACCCAATCTTGGGATGTATCG
CGTGCAACGGTTCAATCAAAACACCATGGGCCTCCATTTTCAAATCCAGA
AGGGCGGAGGGATGCATCTGTATGAAGCAGAGCAAAAAAAGCAAAACCTT
CCTGTTTCGGTATTTTTGTCTGGAAACCCCTTTTTAACCCTTTCTGCGAT
TGCCCCCCTACCTGAGAATGTCTCGGAACTTCTCTTTGCTACCTTCCTCC
AAGGAGCGAAGCTCCTTTATAAAAAAACAAACGACCATCCCCACCCTCTA
CTCTACGATGCGGAATTCATCCTGGTCGGAGAATCTCCGGCCGGGAAACG
TCGTCCTGAAGGTCCTTTTGGCGATCATTTCGGATACTACAGTCTCCAAC
ATGACTTCCCTGAATTCCACTGTCATAAAATCTATCACAGAAAAGATGCA
ATCTATCCTGCTACAGTAGTCGGCAAACCCTACCAAGAAGATTTTTATAT
AGGGAACAAACTCCAAGAATACCTCTCCCCTTTATTTCCGTTAGTTATGC
CTGGTGTGCGTAGACTTAAAAGTTACGGAGAATCAGGGTTTCATGCACTG
ACTGCGGCTGTCGTTAAAGAACGCTATTGGAGAGAATCTCTAACCACAGC
TCTTAGAATTCTTGGAGAGGGCCAACTTTCCCTAACGAAATTCCTAATGG
TCACAGACCAAGAGGTGCCTCTCGACAGGTTCTCCGTGGTTCTAGAAACC
ATTTTAGAGCGTCTACAGCCAGACCGAGATCTTATTATTTTCTCAGAAAC
TGCAAACGATACGTTAGACTATACAGGACCAAGCTTAAATAAGGGCTCCA
AGGGAATCTTCATGGGAATAGGAAAAGCCATCCGAGACCTTCCCCATGGA
TATCAGGGAGGAAAAATCCATGGAGTTCAAGACATCGCTCCCTTTTGTCG
TGGTTGCCTAGTGTTGGAAACATCCCTCGAGGACCGATGTATTAAATCTC
TCCTTCACCATCCAGATCTAAAATCATGGCCTCTGATTATCCTTGCCGAT
AATCTGAGAGAAACCATTCAAAGTGAAAAAGATTTTCTCTGGAGGACCTT
CACACGATGTGCCCCAGCAAATGATCTTCACGCGCTCCACAGCCATTTTG
CTACTCACCGTCCTAATTACAACTTTCCCTTCGTTATCGATGCCCTGATG
AAGCCTTCCTATCCTAAAGAAGTAGAGGTCGACCCATCTACAAAACAAAA
GGTTTCCGAACGATGGCACGCATATTTCCCCAATAAAGAAACTTTTTATA
TTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy