Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR267 IGR272 IGR269 IGR266 IGR271 IGR270 IGR268 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 sycE, - CPn0325 sycE, - CPn0325
* Calculated from Protein Sequence

Gene ID: CPn0327

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl28  

Definition:
50S ribosomal protein L28

Gene Start:
372945

Gene Stop:
373214

Gene Length:
270

Molecular Weight*:
10347

pI*:
12.10

Net Charge*:
22.17

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to M. genitalium,
T. pallidum, or U. urealyticum.

CPn0327 is orthologously related to CT086:
residues 1-89 is 80% similar to that of CT 086.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0227
COG name: Ribosomal protein L28
Functional Class:  J
The phylogenetic pattern of COG0227 is ----yqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 76 (E-value = 3.3e-13) place CPn0327 in the Ribosomal_L28 family which is described as Ribosomal L28 family (PF00830)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
89

PDB Hit:


Gene Protein Sequence:
MSRKCPLTGKRPRRGYSYTLRGIAKKKKGIGLKVTGKTKRRFFPNMLTKR
LWSTEENRFLKLKISASALRHIDKLGLEKVLERAKSKNF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAGAAAGTGCCCACTTACAGGAAAGAGACCTCGCCGTGGTTATAG
CTATACACTTCGAGGTATTGCTAAAAAGAAAAAAGGAATTGGTTTGAAAG
TGACAGGGAAGACTAAAAGAAGATTTTTCCCTAATATGTTGACCAAGCGT
CTATGGTCTACAGAAGAAAACCGTTTTCTTAAGCTTAAAATTTCTGCTAG
CGCTCTTCGTCACATTGATAAGCTCGGATTAGAGAAAGTTCTCGAAAGAG
CTAAAAGTAAAAATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy