Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR267 IGR272 IGR269 IGR266 IGR271 IGR270 IGR268 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 CPn0330 CPn0331 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 CPn0331 CPn0330 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 sycE, - CPn0325 sycE, - CPn0325
* Calculated from Protein Sequence

Gene ID: CPn0326

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
malQ  

Definition:
4-alpha-glucanotransferase (amylomaltase)

Gene Start:
371148

Gene Stop:
372728

Gene Length:
1581

Molecular Weight*:
60950

pI*:
7.40

Net Charge*:
3.12

EC:
2.4.1.25  

Functional Class:
energy metabolism; sugars  

Pathway: pathway table
Starch and sucrose metabolism

Comment:
See CT087.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to 4-alpha-glucanotransferase sequences; e.g. residues 16-522 are 57% similar to CT087, a predicted 4-alpha-glucanotransferase (amylomaltase); residues 4-524 are 61% similar to (U88070) No definition line found [Chlamydophila caviae]; residues 41-504 are 28% similar to (D90900) 4-alpha-glucanotransferase [Synechocystis sp.]; and residues 41-506 are 26% similar to (L37874) 4-alpha-glucanotransferase [Clostridium butyricum].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1640
COG name: 4-alpha-glucanotransferase
Functional Class:  G
The phylogenetic pattern of COG1640 is -----q-ce-rh----o-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-505 are 65% similar to a defined domain of O34022_CHLPS, defined as: 4-ALPHA-GLUCANOTRANSFERASE TRANSFERASE GLYCOSYLTRANSFERASE AMYLOMALTASE DISPROPORTIONATING ENZYME D-ENZYME CARBOHYDRATE METABOLISM PUTATIVE.
Residues 339-509 are 33% similar to a defined domain of O22198_ARATH, defined as: PUTATIVE 4-ALPHA-GLUCANOTRANSFERASE. TRANSFERASE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 29 to 523 (E-value = 9.1e-277) place CPn0326 in the 4a_glucanotrans family which is described as 4-alpha-glucanotransferase (PF02446)

PDB Hit:


Gene Protein Sequence:
VNVLKYTKHSPSAHAWKLIGTSPKHGIYLPLFSIHTKNSCGIGEFLDLIP
LISWCQKQGFSVIQLLPLNDTGEDTSPYNSISSVALNPLFLSLSSLPNID
TIPEVAKKLQDMHELCSTPSVSYTQVKEKKWAFLREYYQKCCKSSLEGNS
NFSEFLESERYWLYPYGTFRAIKHHMHGEPINNWPKSLTDQENFPDLTKK
FHDEVLFFSYLQFLCYQQLCEVKAYADQHHVLLKGDLPILISKDSCDVWY
FRDYFSSSRSVGAPPDLYNSEGQNWHLPIYNFSQLAKDDYIWWKERLRYA
QNFYSVYRLDHIIGFFRLWIWDSSGRGRFIPDNPKDYIKQGTEILSTMLG
ASSMLPIGEDLGIIPQDVKTTLTHLGICGTRIPRWERNWESDSAFIPLKD
YNPLSVTTLSTHDSDTFAQWWLNSPKEAKQFAKFLHLPFQKTLTTETQID
ILKLSHESASIFHINLFNDYLALCPDLVSKNLQRERINTPGTISKKNWSY
RVRPSLEELAIHKKFNGYIEKILTGL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATGTTTTAAAATACACAAAACACTCACCCTCAGCACATGCTTGGAA
ACTTATAGGAACCTCTCCTAAACACGGGATTTATCTCCCACTATTTTCAA
TACACACAAAAAATAGCTGTGGAATCGGTGAATTTTTAGATCTCATTCCT
CTGATCTCTTGGTGCCAAAAACAGGGCTTCAGCGTTATTCAGCTTCTCCC
TTTAAATGATACTGGTGAAGATACGAGTCCCTATAACAGCATCTCTTCCG
TAGCCCTGAATCCCCTATTCCTTTCCCTATCCTCTCTTCCAAATATCGAT
ACCATCCCTGAAGTTGCCAAGAAACTTCAAGATATGCATGAGTTATGCTC
GACTCCATCAGTCAGCTATACTCAAGTTAAAGAAAAAAAATGGGCATTCT
TAAGAGAGTACTACCAAAAATGTTGCAAGTCTTCCCTCGAAGGAAACTCA
AATTTTTCTGAGTTTCTAGAAAGCGAGCGCTATTGGCTTTATCCCTATGG
GACCTTTCGTGCAATCAAACATCATATGCACGGAGAACCTATTAATAACT
GGCCGAAGTCGCTCACAGATCAGGAGAATTTTCCGGACTTAACTAAAAAA
TTCCATGATGAAGTCCTCTTTTTTTCCTATCTACAGTTTCTCTGTTACCA
ACAGCTCTGCGAAGTGAAAGCCTATGCAGATCAACACCACGTCCTGCTTA
AAGGAGACCTCCCTATTCTTATTAGCAAGGATAGCTGTGATGTTTGGTAT
TTCCGAGACTACTTTTCTTCATCAAGGTCTGTAGGAGCTCCTCCTGACCT
CTACAATTCTGAAGGACAAAACTGGCATCTGCCTATTTATAATTTTTCAC
AACTTGCCAAAGACGACTACATTTGGTGGAAAGAGCGTCTGCGATATGCT
CAAAACTTCTATTCCGTCTATCGCTTAGATCATATTATAGGATTTTTCCG
TTTGTGGATTTGGGATTCTTCAGGAAGAGGAAGGTTCATTCCAGACAATC
CTAAAGACTATATAAAGCAGGGCACGGAGATCCTTTCTACTATGCTCGGA
GCCTCTTCTATGTTACCTATCGGAGAAGATTTAGGGATTATACCCCAAGA
CGTCAAAACGACATTAACACACTTAGGAATCTGTGGAACCCGGATTCCAC
GATGGGAACGCAACTGGGAAAGCGACAGTGCCTTCATTCCCCTAAAAGAT
TATAATCCACTTTCTGTGACCACTCTCTCTACCCACGACTCTGATACGTT
TGCCCAATGGTGGCTCAATTCACCTAAGGAAGCTAAGCAATTTGCTAAAT
TTCTACATCTTCCTTTTCAAAAAACCCTGACTACAGAAACTCAAATAGAC
ATCTTAAAACTTTCTCATGAATCAGCATCTATCTTTCATATCAACCTCTT
TAACGATTATCTCGCCCTCTGCCCTGATTTAGTATCAAAAAATCTACAAA
GAGAACGCATTAATACACCTGGGACAATTTCTAAAAAGAATTGGTCGTAT
CGAGTTCGGCCTTCCTTAGAAGAACTCGCTATTCATAAAAAATTTAATGG
TTACATTGAGAAGATCCTTACAGGACTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy