Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR267 IGR269 IGR266 IGR270 IGR268 IGR265 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 rl28, - CPn0327 CPn0329 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 CPn0328 sctV,lcrD, - CPn0323 sycE, - CPn0325 sycE, - CPn0325
* Calculated from Protein Sequence

Gene ID: CPn0325

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sycE  

Definition:
probable chaperone for type III pathway

Gene Start:
370708

Gene Stop:
371151

Gene Length:
444

Molecular Weight*:
16456

pI*:
4.80

Net Charge*:
-5.33

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane transport; Type III secretion system

Comment:
This gene is a homolog of one of four genes in C. trachomatis and C. psittaci that appear to be involved in type III,
virulence-associated, contact-dependent, secretion. Other genes
in this cluster found in C. pneumoniae are CPn0322, CPn0323, and CPn0324. A second cluster of interest is CPn0823, CPn0824, CPn0825, CPn0826, and CPn0828.
As many as 20 membrane proteins may be
involved in this system. See Bavoil and Hsia, Mol. Microbiol. 28(4):860,
1998 and Hueck, CJ. 1998. Micro. and Molecular Biology Reviews
62(2): 379-433.

One of four genes whose products make up the putative type III,
virulence-associated, contact-dependent, secretion pathway. FHIPEP (flagella/HR/invasion proteins export pore) family proteins.

Blast Summary:  PSI-Blast Search
CPn0325 is orthologously related to CT088: residues 1-146 of CPn0325 are 63% similar to residues 1-146 of CT088, a predicted chaperone for type III pathway secretion from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MQNQYEQLLESLAPLLNTTLAPDKNNSCLIRFSDTHVPVQIEEDGNSGDL
AVSTLLGTLPENVFRERIFKAALSVNGSFQSSIKGILGYGEVTQQLYLSD
ILSMNYLNGEKLFEYLKLFSLHAKIWMESLRTGNLPDLHVLGIYYVA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAAACCAATACGAGCAATTACTAGAATCCTTAGCACCCCTATTAAA
TACGACACTTGCTCCAGATAAAAATAACTCTTGTTTAATCCGTTTCAGCG
ATACCCATGTCCCTGTGCAAATAGAAGAAGATGGAAATTCCGGAGATCTT
GCAGTATCGACACTACTAGGTACTCTTCCTGAAAACGTATTTCGCGAGCG
TATTTTCAAAGCTGCTCTCTCTGTAAATGGCTCGTTCCAATCCAGCATCA
AGGGAATTCTAGGCTACGGTGAGGTCACTCAACAGCTCTATCTTTCAGAT
ATCCTGAGTATGAACTACCTAAATGGAGAAAAGTTATTCGAGTATCTCAA
GCTCTTTTCTTTGCATGCTAAGATTTGGATGGAATCCCTAAGAACAGGGA
ATCTTCCTGACCTTCATGTTTTGGGAATCTACTACGTCGCGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy