Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR263 IGR267 IGR266 IGR264 IGR265 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 malQ, - CPn0326 sctV,lcrD, - CPn0323 infB, - CPn0317 sycE, - CPn0325 truB, - CPn0319 sycE, - CPn0325 truB, - CPn0319
* Calculated from Protein Sequence

Gene ID: CPn0322

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yscU  sctU  

Definition:
cds1 or FlhB-like flagellar protein; Yop translocation protein U

Gene Start:
366249

Gene Stop:
367331

Gene Length:
1083

Molecular Weight*:
40398

pI*:
10.30

Net Charge*:
14.41

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table
Membrane Transport; Type III Secretion System

Comment:
This gene is a homolog of one of four genes in C. trachomatis and C.
psittaci that appear to be involved in type III,
virulence-associated, contact-dependent, secretion. Other genes
in this cluster found in C. pneumoniae are CPn0323, CPn0324, and CPn0325.
A second cluster of interest is CPn0823, CPn0824, CPn0825, CPn0826, and
CPn0828.
As many as 20 membrane proteins may be
involved in this system. See Bavoil and Hsia, Mol. Microbiol. 28(4):860,
1998 and Hueck, CJ. 1998. Micro. and Molecular Biology Reviews
62(2): 379-433.

One of four genes whose products make up the putative type III,
virulence-associated, contact-dependent, secretion pathway. FHIPEP
(flagella/HR/invasion proteins export pore) family proteins.

See also CPn0702, CPn0707, and CPn1021.

YopU translocation protein is a component of the Yop secretion machinery.
It is an integral membrane protein with similarity to the FlhB (flagellar)/HrpN/YscU/SpaS family.


Blast Summary:  PSI-Blast Search
CPn0322 is orthologously related to CT091: residues 1-360 of CPn0322 are 82% similar to residues 1-360 of CT091, a predicted cds1 or FLHB-like flagellar protein from C. trachomatis.
CPN0322 is also similar to TP0715, a predicted flagellar export protein (flagellar biosynthetic protein) from T. pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1377
COG name: Predicted membrane protein FlhB involved in flagellar biogenesis
Functional Class:  N
The phylogenetic pattern of COG1377 is -----qV-eB--UJ--oLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 342 (E-value = 2.4e-162) place CPn0322 in the Bac_export_2 family which is described as FlhB HrpN YscU SpaS Family (PF01312)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
34  
53
transmembrane  
80  
104
transmembrane  
141  
158
transmembrane  
163  
180
transmembrane  
185  
202

PDB Hit:


Gene Protein Sequence:
MGEKTEKATPKRLRDARKKGQVAKSQDFPSAVTFIVSMFTAFSLSTFFFK
HLGGFLVSMLSQAPTRHDPVITLFYLKNCLMLILTASLPLLGAVAVVGVI
VGFLIVGPTFSTEVFKPDIKKFNPIENIKQKFKIKTLIELIKSILKIFGA
ALILYITLKSKVSLIIETAGVSPIITAQIFKEIFYKAVTSIGIFFLIVAI
LDLVYQRHNFAKELKMEKFEVKQEFKDTEGNPEIKGRRRQIAQEIAYEDS
SSQVKHASTVVSNPKDIAVAIGYMPEKYKAPWIIAMGINLRAKRILDEAE
KYGIPIMRNVPLAHQLLDEGKELKFIPESTYEAIGEILLYITSLNAQNPN
NKNTNQPDHL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGAAAAAACAGAAAAGGCCACGCCGAAGCGACTTAGAGATGCTCG
GAAAAAAGGTCAAGTAGCAAAATCTCAGGATTTTCCTTCTGCGGTTACCT
TTATCGTCTCTATGTTTACGGCTTTCTCCCTATCGACCTTTTTTTTCAAG
CATTTAGGTGGCTTTCTGGTTTCCATGCTCTCACAAGCTCCCACTCGCCA
TGATCCTGTAATTACCTTATTTTATCTTAAGAACTGTCTTATGCTTATTT
TAACAGCATCACTTCCCTTACTGGGAGCTGTTGCTGTTGTTGGCGTCATT
GTAGGTTTTCTTATCGTTGGTCCTACATTTTCTACCGAAGTTTTTAAACC
AGATATCAAGAAGTTCAACCCTATTGAGAACATCAAACAAAAGTTTAAAA
TAAAGACTCTCATAGAGCTGATCAAATCGATTTTAAAAATTTTTGGAGCA
GCCTTAATTTTATACATAACGTTAAAAAGCAAAGTCTCTTTAATTATAGA
AACTGCAGGAGTCTCTCCTATAATTACTGCTCAAATCTTCAAAGAAATTT
TTTATAAAGCAGTAACCTCGATAGGAATTTTCTTTTTGATTGTTGCGATT
CTTGACCTTGTCTATCAGCGCCACAATTTCGCTAAAGAATTAAAGATGGA
GAAGTTTGAGGTTAAGCAGGAGTTTAAAGACACGGAAGGAAATCCTGAGA
TTAAAGGCCGTCGTCGACAAATTGCTCAAGAAATTGCCTATGAAGACTCG
TCATCACAGGTGAAACATGCAAGCACCGTAGTCTCTAATCCCAAAGATAT
TGCTGTTGCTATTGGCTACATGCCTGAAAAATATAAAGCACCTTGGATCA
TTGCCATGGGCATCAACTTACGAGCTAAAAGGATACTTGATGAAGCTGAA
AAGTACGGAATTCCCATTATGCGAAACGTACCTTTAGCACATCAGCTTTT
GGATGAAGGGAAGGAATTAAAATTTATTCCAGAATCTACTTACGAAGCTA
TTGGAGAAATTCTACTCTATATCACTTCACTGAATGCGCAAAATCCTAAT
AATAAAAATACTAACCAACCTGATCATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy