Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR263 IGR266 IGR264 IGR265 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 copN,sctW,lcrE, - CPn0324 sctV,lcrD, - CPn0323 infB, - CPn0317 truB, - CPn0319 truB, - CPn0319
* Calculated from Protein Sequence

Gene ID: CPn0321

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ychF  

Definition:
conserved GTP-binding protein

Gene Start:
365858

Gene Stop:
364764

Gene Length:
1095

Molecular Weight*:
40045

pI*:
5.20

Net Charge*:
-12.60

EC:
 

Functional Class:
cellular processes; signal transduction  
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GTP Binding Protein sequences; e.g. residues 5-364 are 53% similar to YCHF_HAEIN; residues 5-364 are 53% similar to YCHF_ECOLI; residues 7-364 are 49% similar to (AE000571) GTP-binding protein (gtp1) [Helicobacter pylori 26695]; residues 1-364 are 74% similar to CT092; residues 6-364 are 46% similar to TP0124; residues 7-364 are 44% similar to UU595; and residues 7-364 are 44% similar to MG024.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0012
COG name: Predicted GTPase
Functional Class:  R
The phylogenetic pattern of COG0012 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-47 and 75-96 represent blocks BL00905B-C (GTP1/OBG family proteins) with a combined E-value of 4.6e-16.

ProDom Summary:  Protein Domain Search
Residues 162-364 are 50% similar to a defined domain of YCHF_HAEIN, defined as: PROTEIN GTP-BINDING PROBABLE INTERGENIC REGION CHROMOSOME I PUTATIVE MG024 C27E2.03C.
Residues 69-158 are 56% similar to a defined domain of P73886_XXXXX, defined as: PROTEIN GTP-BINDING INTERGENIC REGION PROBABLE DEVELOPMENTALLY REGULATED DRG CHROMOSOME RIBOSOMAL.
Reisdues 5-44 are 72% similar to a defined domain of YCHF_HAEIN, defined as: PROTEIN GTP-BINDING INTERGENIC REGION HOMOLOG IRON TRANSPORT ERA PROBABLE FERROUS.

Paralogs:  Local Blast Search
CPn0544 is a possible paralog: residues 5-133 are 33% similar to CPn0544.

Pfam Summary:  Pfam Search
Residues 125 to 364 (E-value = 5.6e-137) place CPn0321 in the DUF933 family which is described as Protein of unknown function (DUF933) (PF06071)

PDB Hit:


Gene Protein Sequence:
MSHTECGIVGLPNVGKSGLFNALTGAQVASCNYPFCTIDPNVGIVPVIDE
RLEALAKISNSQKIIYADMKFVDIAGLVKGASDGAGLGNRFLSHIRETHA
IAHVVRCFDDPDVTHVSGKVNPVEDIEVINLELIFSDFSSAKNIHSKLEK
LAKGKREVGALLPLFDTIIAHLEKGLPLRTLELTPEQIVALKPYPFLTMK
PMFYIANVDESSLPDMDNDYVAAVREVAAKENSKVVPICVRIEEEIVSLP
IEERLEFLMSLGLEKSGLHRLVRAAYDTLGLISYFTTGPQESRAWTVVRG
SSAWEAAGEIHTDIQKGFIRAEVITFEDMIECQGRAAARELGKLHIEGRD
YIVQDGDTMLFLHN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTCATACTGAATGTGGAATTGTAGGGCTTCCTAATGTAGGAAAGTC
TGGCTTATTCAATGCTTTAACAGGAGCTCAAGTTGCCTCCTGTAACTATC
CGTTTTGTACTATCGATCCTAATGTGGGTATTGTTCCTGTTATCGATGAA
AGACTGGAAGCCTTAGCTAAAATTAGCAATAGTCAGAAGATCATCTATGC
GGATATGAAATTTGTAGATATTGCAGGTTTAGTTAAGGGAGCTTCCGATG
GCGCGGGTCTGGGAAATCGGTTTCTCTCTCATATTCGAGAAACTCATGCT
ATTGCTCATGTAGTGCGTTGTTTTGATGATCCAGACGTTACACACGTTTC
AGGAAAAGTCAACCCTGTTGAGGATATTGAAGTTATCAACTTAGAGCTCA
TTTTTTCTGACTTCTCCTCAGCAAAAAATATCCATAGCAAATTAGAAAAG
CTAGCCAAAGGAAAGCGTGAAGTAGGAGCTCTCTTGCCTCTATTTGATAC
AATTATTGCTCACTTAGAAAAGGGGCTGCCGCTACGTACTTTAGAATTAA
CTCCAGAACAAATTGTGGCATTAAAGCCCTATCCGTTTTTGACCATGAAG
CCTATGTTTTATATAGCTAATGTTGACGAGAGTTCTCTACCAGATATGGA
TAATGATTATGTTGCCGCTGTTCGGGAAGTTGCTGCAAAAGAAAATTCTA
AAGTGGTTCCTATCTGTGTTCGTATAGAAGAAGAAATCGTTTCCTTACCT
ATTGAAGAGCGCTTAGAATTTCTTATGAGCTTAGGTCTTGAAAAATCAGG
ACTTCATAGATTAGTGCGTGCTGCGTATGACACTTTAGGACTGATTTCTT
ATTTTACTACAGGTCCTCAAGAATCTCGTGCATGGACAGTGGTTCGAGGG
TCTTCTGCTTGGGAAGCTGCTGGAGAAATCCATACGGATATTCAAAAGGG
CTTTATTCGTGCTGAAGTGATTACTTTTGAAGATATGATAGAGTGTCAAG
GTCGTGCAGCTGCTCGAGAATTAGGGAAATTACATATAGAAGGACGTGAT
TATATCGTCCAGGACGGTGATACTATGCTGTTCCTTCATAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy