Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR263 IGR264 IGR265 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 sctV,lcrD, - CPn0323 infB, - CPn0317 truB, - CPn0319 nusA, - CPn0316 truB, - CPn0319 nusA, - CPn0316
* Calculated from Protein Sequence

Gene ID: CPn0320

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribF  

Definition:
riboflavin kinase

Gene Start:
363860

Gene Stop:
364786

Gene Length:
927

Molecular Weight*:
34110

pI*:
6.10

Net Charge*:
-4.35

EC:
2.7.1.26  2.7.7.2  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; riboflavin  

Pathway: pathway table
Riboflavin metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0320 is orthologously related to CT093, a predicted riboflavin kinase:
residues 1-294 are 48% similar to CT093. CPn093 is also similar
to UU355, MG145 and TP0888.



COGS Summary:  COGS Search
BeTs to 11 clades of COG0196
COG name: FAD synthase
Functional Class:  H
The phylogenetic pattern of COG0196 is ----yqvceBrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 160 (E-value = 3.2e-53) place CPn0320 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)
Residues 176 to 298 (E-value = 3.7e-30) place CPn0320 in the FAD_Synth family which is described as Riboflavin kinase / FAD synthetase (PF01687)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
67

PDB Hit:


Gene Protein Sequence:
MPMEIAYSLTSSFSVDSVTVGFFDGCHLGHSNLLSILTSYSGSSGVITFD
SHPQTVLSLNHTKLINTKEERLQLLQTFPIDWLGVLTFDLNFANQSAEEF
LTLLHRNLKCKRLILGYDSCIGKEQQSNTEALDTIGKPLGIEVIKIPPYR
MDNIVVSSKAIRQFLSAGNLECAHRFLGHPYAISGKITEGSGIGGSLGFA
TINLPREESLIPLGVYACEIRYDSTTCQGVMNLGTAPTFGRESLYAEAHI
FSFAENLYGKEVSIIPRKFLREEKKFQSKETLIRAIEKDILDAQDWFAKG
SFNYEGTA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCATGGAAATAGCCTATAGTTTAACGTCTTCGTTTTCTGTAGATTC
TGTAACTGTAGGTTTTTTCGACGGATGTCATCTAGGGCATAGCAATCTTT
TATCTATTCTTACTTCCTATTCTGGATCCAGTGGAGTTATTACCTTTGAT
TCTCATCCTCAAACGGTACTTTCTTTAAATCACACGAAACTCATCAATAC
AAAAGAAGAGCGCCTCCAATTATTGCAAACGTTTCCCATAGACTGGTTAG
GTGTCCTTACTTTTGATTTAAATTTTGCGAATCAATCGGCAGAAGAATTT
CTTACTTTGTTACATCGTAACTTGAAATGCAAACGCCTCATCTTAGGTTA
TGATTCTTGCATAGGGAAAGAACAGCAAAGCAATACCGAGGCTCTCGATA
CTATAGGCAAGCCGTTAGGTATAGAGGTCATCAAGATTCCTCCTTACCGT
ATGGATAACATAGTTGTCTCCAGCAAAGCAATCCGCCAGTTTCTGTCCGC
AGGGAATCTTGAATGTGCTCATCGTTTTTTGGGTCATCCCTATGCCATTT
CTGGAAAAATAACCGAGGGCTCCGGAATAGGAGGTTCTCTAGGATTCGCC
ACTATAAATCTTCCTAGAGAAGAAAGTTTAATTCCCCTAGGAGTTTATGC
TTGTGAAATACGTTATGATAGCACTACCTGTCAGGGTGTTATGAATTTAG
GAACTGCCCCTACTTTTGGAAGAGAGTCTTTATATGCAGAGGCGCATATC
TTTTCCTTTGCGGAAAATCTATACGGCAAAGAAGTGAGCATTATCCCGAG
AAAATTTCTTAGAGAAGAAAAAAAGTTTCAATCAAAAGAAACTCTAATAC
GAGCAATTGAAAAAGACATTTTGGATGCTCAAGATTGGTTTGCAAAGGGT
TCCTTTAATTATGAAGGAACAGCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy