Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR263 IGR264 IGR262 IGR265 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 rs1, - CPn0315 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 rs1, - CPn0315 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 sctV,lcrD, - CPn0323 infB, - CPn0317 truB, - CPn0319 nusA, - CPn0316 truB, - CPn0319 nusA, - CPn0316 rs1, - CPn0315
* Calculated from Protein Sequence

Gene ID: CPn0319

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
truB  

Definition:
tRNA pseudouridine 55 synthase

Gene Start:
363175

Gene Stop:
363882

Gene Length:
708

Molecular Weight*:
26303

pI*:
7.90

Net Charge*:
2.98

EC:
 

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table

Comment:
tRNA pseudourindine synthase functions in the formation of pseudouridine in the anticodon stem and loop of transfer RNAs.
It belongs to the Nap57/Cbf5/TruB family of proteins.


Blast Summary:  PSI-Blast Search
CPn0319 is orthologously related to CT094: residues 1-232 of CPn0319 are 82% similar to residues 1-232 of CT094, a predicted tRNA pseudouridine 55 synthase from C. trachomatis.
CPn0319 is also similar to UU354, TP0889.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0130
COG name: Pseudouridine synthase
Functional Class:  J
The phylogenetic pattern of COG0130 is amtkYqvcebrh----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 27 to 177 (E-value = 6.7e-50) place CPn0319 in the TruB_N family which is described as TruB family pseudouridylate synthase (N terminal domain) (PF01509)

PDB Hit:


Gene Protein Sequence:
MDLAVELKEGILLVDKPQGRTSFSLIRALTKLIGVKKIGHAGTLDPFATG
VMVMLIGRKFTRLSDILLFEDKEYEAIAHLGTTTDSYDCDGKVVGRSKKI
PSLEEVLSAAEYFQGEIQQLPPMFSAKKVQGKKLYEYARKGLSIERHHST
VQVHLQITKYEYPLLHFVVSCSKGTYIRSIAHELGTMLGCGAYLEQLRRL
RSGRFSIDECIDGNLLDHPDFDISPYLRDAHGNSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCTTGCAGTAGAATTAAAAGAGGGCATTCTTCTTGTAGACAAGCC
TCAAGGGAGAACTTCGTTTAGCCTTATCCGCGCTCTAACCAAGTTAATAG
GCGTTAAAAAGATTGGTCATGCAGGAACTTTAGATCCCTTCGCTACTGGC
GTTATGGTCATGTTGATTGGCCGTAAATTTACTAGACTTTCTGATATTTT
ACTTTTTGAAGACAAGGAATACGAAGCAATTGCCCATTTAGGGACAACTA
CCGATTCTTATGATTGCGACGGCAAAGTTGTAGGAAGATCTAAGAAGATT
CCTAGTCTCGAAGAAGTATTATCAGCTGCCGAGTATTTCCAAGGAGAGAT
CCAGCAACTGCCTCCCATGTTTTCCGCTAAAAAAGTCCAAGGGAAAAAGC
TGTATGAATATGCTAGAAAAGGTTTATCTATAGAACGTCACCATTCTACA
GTTCAAGTTCACTTGCAGATTACGAAATATGAGTACCCTTTATTGCATTT
TGTAGTCTCTTGTAGCAAAGGAACTTATATTCGCAGCATTGCTCATGAGC
TTGGCACGATGTTAGGCTGTGGAGCTTATCTTGAGCAGCTACGCCGTTTA
CGCAGTGGCCGTTTTTCTATAGATGAATGTATTGATGGGAATCTATTAGA
CCACCCCGATTTCGATATTTCTCCCTACCTACGAGATGCCCATGGAAATA
GCCTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy