Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR263 IGR264 IGR262 IGR265 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 rs1, - CPn0315 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 rs1, - CPn0315 sctV,lcrD, - CPn0323 infB, - CPn0317 ychF, - CPn0321 rbfA, - CPn0318 ribF, - CPn0320 yscU,sctU, - CPn0322 rs1, - CPn0315 sctV,lcrD, - CPn0323 infB, - CPn0317 truB, - CPn0319 nusA, - CPn0316 truB, - CPn0319 nusA, - CPn0316
* Calculated from Protein Sequence

Gene ID: CPn0318

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rbfA  

Definition:
ribosome binding factor A

Gene Start:
362767

Gene Stop:
363129

Gene Length:
363

Molecular Weight*:
13956

pI*:
10.00

Net Charge*:
4.19

EC:
 

Functional Class:
translation; translation factors  

Pathway: pathway table

Comment:
In E.coli, this protein is said to be essential for processing of 16S
rRNA.
Ribosome-binding factor A associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Involved in a late step of 30S maturation or in translational initiation. May interact with the 5' terminal helix region of 16S sRNA.
CPn0318 appears to be Chlamydia-specific.

Blast Summary:  PSI-Blast Search
CP0318 is orthologously related to CT095: residues 1-119 of CPn0318 are 73% similar to residues 1-119 of CT095, a predicted ribosome binding factor A in C. trachomatis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0858
COG name: Ribosome-binding factor A
Functional Class:  J
The phylogenetic pattern of COG0858 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 111 (E-value = 1.8e-18) place CPn0318 in the RBFA family which is described as Ribosome-binding factor A (PF02033)

PDB Hit:


Gene Protein Sequence:
MTENRRIKRVNALLQEAIAKVILKDVKHPKISNLWITVTRVSLSKDLHSA
RVYVSVMPHENTKEEALEALKVSAGFIAHRASKNVVLKYFPELHFYLDDI
FSPQDYIENLLWQIQEKEKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGAAAATAGACGTATTAAACGGGTAAATGCTTTATTACAAGAAGC
CATTGCAAAGGTAATTTTAAAAGATGTTAAGCATCCCAAGATTTCTAATC
TTTGGATCACGGTAACTCGTGTTTCTCTATCTAAGGATTTGCACTCTGCA
CGTGTTTATGTATCTGTAATGCCTCATGAGAATACCAAGGAAGAGGCTTT
AGAAGCTTTAAAAGTCTCTGCTGGTTTTATCGCTCATAGAGCTTCGAAAA
ATGTCGTCCTTAAATATTTCCCAGAACTTCATTTTTATCTCGATGATATT
TTCTCACCTCAAGATTATATAGAAAACCTGCTTTGGCAGATTCAAGAGAA
AGAAAAGAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy