Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR263 IGR259 IGR262 IGR258 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 CPn0310 rbfA, - CPn0318 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 CPn0310 rbfA, - CPn0318 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 CPn0310 rbfA, - CPn0318 CPn0312 rs1, - CPn0315 infB, - CPn0317 nusA, - CPn0316 nusA, - CPn0316 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0315

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs1  

Definition:
30S ribosomal protein S1

Gene Start:
356977

Gene Stop:
358719

Gene Length:
1743

Molecular Weight*:
65011

pI*:
5.00

Net Charge*:
-20.39

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0315 is similar to TP0279 in T. pallidum,
a predicated 30S ribosomal protein S1/ cytidylate kinase

CPn0315 is orthologously related to CT098:
residues 1-551 are 90% similar to that of CT098.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0539
COG name: Ribosomal protein S1
Functional Class:  J
The phylogenetic pattern of COG0539 is ----YqvCebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 48 to 116 (E-value = 7.2e-15) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 130 to 199 (E-value = 3.4e-17) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 216 to 288 (E-value = 1.1e-20) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 301 to 375 (E-value = 4.6e-24) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 388 to 462 (E-value = 4.9e-22) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)
Residues 475 to 548 (E-value = 7e-22) place CPn0315 in the S1 family which is described as S1 RNA binding domain (PF00575)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
38  
113
coil-coil  
187  
217

PDB Hit:


Gene Protein Sequence:
MPKQAEYTWGSKKILDNIECLTEDVAEFKDLLYTAHRITSSEEESDNEIQ
PGAILKGTVVDINKDFVVVDVGLKSEGVIPMSEFIDSSEGLVLGAEVEVY
LDQAEDEEGKVVLSREKATRQRQWEYILAHCEEGSIVKGQITRKVKGGLI
VDIGMEAFLPGSQIDNKKIKNLDDYVGKVCEFKILKINVERRNIVVSRRE
LLEAERISKKAELIEQISIGEYRKGVVKNITDFGVFLDLDGIDGLLHITD
MTWKRIRHPSEMVELNQELEVIILSVDKEKGRVALGLKQKEHNPWEDIEK
KYPPGKRVLGKIVKLLPYGAFIEIEEGIEGLIHISEMSWVKNIVDPSEVV
NKGDEVEAIVLSIQKDEGKISLGLKQTERNPWDNIEEKYPIGLHVNAEIK
NLTNYGAFVELEPGIEGLIHISDMSWIKKVSHPSELFKKGNSVEAVILSV
DKESKKITLGVKQLSSNPWNEIEAMFPAGTVISGVVTKITAFGAFVELQN
GIEGLIHVSELSDKPFAKIEDIISIGENVSAKVIKLDPDHKKVSLSVKEY
LADNAYDQDSRTELDFKDSQGPKERKKKGK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCAAAACAAGCTGAATATACTTGGGGATCTAAAAAAATTCTGGACAA
TATAGAATGCCTCACAGAAGACGTTGCCGAATTTAAAGATTTGCTTTATA
CGGCACACAGAATTACTTCGAGCGAAGAAGAATCTGATAACGAAATACAG
CCTGGCGCCATCCTAAAAGGTACCGTAGTTGATATTAATAAAGACTTTGT
CGTAGTTGATGTTGGTCTGAAGTCTGAGGGAGTGATCCCTATGTCAGAGT
TCATAGACTCTTCAGAAGGTTTAGTGCTTGGAGCTGAAGTAGAAGTCTAT
CTCGACCAAGCCGAAGACGAAGAGGGCAAAGTTGTCCTTTCTAGAGAAAA
AGCCACACGACAACGTCAATGGGAATACATCTTAGCTCATTGTGAAGAAG
GTTCTATTGTTAAAGGTCAAATTACACGTAAAGTCAAAGGCGGCCTTATT
GTAGATATTGGAATGGAAGCCTTCCTACCTGGATCACAAATTGACAACAA
GAAAATCAAAAATTTAGATGATTATGTCGGAAAAGTTTGTGAATTCAAAA
TTTTAAAAATTAACGTTGAACGTCGCAATATTGTTGTCTCAAGAAGAGAA
CTCTTAGAAGCTGAGAGAATCTCTAAGAAAGCCGAACTTATTGAACAAAT
TTCTATCGGAGAATACCGCAAAGGAGTTGTTAAAAACATTACTGACTTTG
GTGTATTCTTAGATCTCGATGGTATTGACGGTCTTCTCCACATTACCGAT
ATGACCTGGAAGCGCATACGACATCCTTCCGAAATGGTCGAATTGAATCA
AGAGTTGGAAGTAATTATTTTAAGCGTAGATAAAGAAAAAGGACGAGTTG
CTCTAGGTCTCAAACAAAAAGAGCATAATCCTTGGGAAGATATTGAGAAG
AAATACCCTCCTGGAAAACGAGTTCTTGGTAAAATTGTGAAGCTTCTCCC
CTACGGAGCTTTCATTGAAATTGAAGAGGGCATTGAAGGTCTAATTCACA
TTTCTGAAATGTCTTGGGTGAAAAATATTGTAGATCCTAGTGAAGTCGTA
AATAAAGGCGATGAAGTTGAAGCCATTGTTCTATCTATTCAGAAGGACGA
AGGAAAAATTTCTCTAGGATTAAAGCAAACAGAACGTAATCCTTGGGACA
ATATCGAAGAAAAATATCCTATAGGTCTCCATGTCAATGCTGAAATCAAG
AACTTAACCAATTACGGTGCTTTCGTTGAATTAGAACCAGGAATTGAGGG
TCTGATTCATATTTCTGACATGAGTTGGATTAAAAAAGTCTCTCACCCTT
CAGAACTATTCAAAAAAGGAAATTCTGTAGAGGCTGTTATTTTATCAGTA
GACAAAGAAAGTAAAAAAATTACTTTAGGAGTTAAGCAATTAAGTTCTAA
TCCTTGGAATGAAATTGAAGCTATGTTCCCTGCTGGCACAGTAATTTCAG
GAGTTGTGACTAAAATCACTGCATTTGGAGCCTTTGTTGAGCTACAAAAC
GGGATTGAAGGATTGATTCACGTTTCAGAACTTTCTGACAAGCCCTTTGC
AAAAATTGAAGATATTATCTCCATTGGAGAAAATGTTTCTGCAAAAGTAA
TTAAGCTAGATCCAGATCATAAAAAAGTTTCTCTTTCTGTAAAAGAATAC
TTAGCTGACAATGCTTATGATCAAGACTCTAGGACTGAATTAGATTTCAA
GGATTCTCAAGGCCCTAAAGAGAGAAAGAAAAAAGGAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy