Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR259 IGR262 IGR258 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0312 rs1, - CPn0315 infB, - CPn0317 nusA, - CPn0316 nusA, - CPn0316 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0314

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trxB  

Definition:
NADPH thioredoxin reductase

Gene Start:
356285

Gene Stop:
355350

Gene Length:
936

Molecular Weight*:
33546

pI*:
6.70

Net Charge*:
-1.02

EC:
1.6.4.5  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; 2'-deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Comment:
See CPn0659, a trxA sequence.

Blast Summary:  PSI-Blast Search
CPn0314 is orthologously related to CT099, a predicted NADPH thioredoxin reductase:
residues 1-310 are 78% similar to CT099. CPn0314 is also similar to
TP0814, UU074 and MG102, all predicted thioredoxin reductases.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0492
COG name: Thioredoxin reductase/alkyl hydroperoxide reductase
Functional Class: O
The phylogenetic pattern of COG0492 is amtkYQVcEBrhUJgpolinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 294 (E-value = 3.3e-85) place CPn0314 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)

PDB Hit:


Gene Protein Sequence:
MIHSRLIIIGSGPSGYTAAIYASRALLHPLLFEGFFSGISGGQLMTTTEV
ENFPGFPEGILGPKLMNNMKEQAVRFGTKTLAQDIISVDFSVRPFILKSK
EETYSCDACIIATGASAKRLEIPGAGNDEFWQKGVTACAVCDGASPIFKN
KDLYVIGGGDSALEEALYLTRYGSHVYVVHRRDKLRASKAMEARAQNNEK
ITFLWNSEIVKISGDSIVRSVDIKNVQTQEITTREAAGVFFAIGHKPNTD
FLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGC
IAALDAERFLG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCATTCCCGGTTAATTATTATTGGTTCAGGTCCATCTGGATATAC
AGCGGCAATTTATGCATCAAGAGCGCTTTTGCATCCTCTTTTATTTGAGG
GGTTTTTCTCTGGGATCTCTGGTGGCCAGCTTATGACTACAACAGAAGTT
GAGAATTTTCCAGGGTTTCCTGAAGGGATTCTTGGGCCAAAACTTATGAA
TAATATGAAGGAGCAGGCTGTGCGGTTTGGGACCAAGACACTAGCTCAAG
ATATTATTTCCGTAGATTTTTCTGTTCGCCCTTTTATTTTGAAATCAAAA
GAAGAAACCTATTCTTGTGATGCCTGTATCATAGCTACAGGAGCTTCTGC
TAAACGTTTAGAAATTCCTGGAGCAGGAAACGATGAATTTTGGCAAAAAG
GAGTGACTGCTTGTGCCGTTTGCGATGGGGCTTCTCCTATTTTTAAAAAT
AAAGATCTTTATGTGATTGGGGGAGGGGATTCTGCTTTAGAAGAAGCTCT
TTACCTGACTCGTTATGGAAGCCACGTATATGTAGTTCATCGTAGAGATA
AACTGCGGGCTTCTAAAGCTATGGAAGCTCGGGCGCAAAACAATGAAAAA
ATTACATTTTTATGGAATAGCGAGATTGTAAAAATTTCTGGAGATAGCAT
TGTCCGTTCCGTAGATATTAAGAATGTTCAGACTCAAGAAATTACAACTA
GAGAAGCTGCGGGGGTGTTCTTTGCTATAGGCCATAAGCCAAATACGGAT
TTTCTCGGAGGACAGCTGACGTTAGATGAGTCGGGCTATATTGTGACTGA
GAAAGGAACGTCCAAGACTTCTGTCCCTGGAGTATTTGCTGCTGGAGATG
TTCAGGATAAGTACTATCGTCAGGCGGTTACTTCTGCAGGAAGTGGTTGT
ATAGCAGCACTAGATGCTGAAAGATTCTTAGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy