Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR259 IGR262 IGR258 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 rs1, - CPn0315 infB, - CPn0317 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0312 rs1, - CPn0315 nusA, - CPn0316 nusA, - CPn0316 infB, - CPn0317 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0313

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
acpS  

Definition:
holo-[acyl-carrier protein] synthase

Gene Start:
354990

Gene Stop:
355358

Gene Length:
369

Molecular Weight*:
13211

pI*:
8.10

Net Charge*:
2.10

EC:
 

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:
Transfers 4'-phosphopantetheine moity from CoA to Ser36 of the acp.

The holo-acyl-carrier protein synthase from Eubacteria is similar to the
C-terminus of fatty acid synthase, alpha subunit from Eukaryotes.

Blast Summary:  PSI-Blast Search
CPn0313 is orthologous to CT100, a predicted holo-[acyl-carrier protein] synthase:
residues 6-120 are 53% similar to CT100. CPn0313 is weakly similar to TP0828. No
similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0736
COG name: Acyl-carrier protein synthase
Functional Class:  I
The phylogenetic pattern of COG0736 is ----Yqv-ebr-uj-polinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 6 to 73 (E-value = 3.5e-25) place CPn0313 in the ACPS family which is described as 4'-phosphopantetheinyl transferase superfamily (PF01648)

PDB Hit:


Gene Protein Sequence:
MEIIHIGTDIIEISRIREAIATHGNRLLNRIFTEAEQKYCLEKTDPIPSF
AGRFAGKEAVAKALGTGIGSVVAWKDIEVFKVSHGPEVLLPSHVYAKIGI
SKVILSISHCKEYATATAIALA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAATCATTCATATAGGAACCGATATTATTGAAATTAGCCGCATTCG
CGAGGCAATTGCAACTCACGGCAATCGACTACTCAATAGAATCTTTACAG
AAGCAGAACAGAAATATTGCTTAGAAAAGACCGATCCCATCCCTTCATTT
GCAGGTCGCTTTGCTGGAAAAGAAGCTGTAGCAAAAGCTTTAGGAACTGG
CATAGGGAGCGTTGTTGCCTGGAAAGACATCGAAGTCTTTAAAGTATCTC
ACGGACCCGAAGTTCTCCTCCCTTCGCATGTCTATGCAAAAATTGGAATT
TCTAAAGTCATTCTCTCTATAAGCCACTGCAAAGAGTATGCCACAGCAAC
TGCAATCGCATTAGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy