Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR259 IGR262 IGR258 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 nusA, - CPn0316 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 acpS, - CPn0313 CPn0312 nusA, - CPn0316 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0312 nusA, - CPn0316 rs1, - CPn0315 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0312

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
354524

Gene Stop:
354979

Gene Length:
456

Molecular Weight*:
17299

pI*:
11.20

Net Charge*:
14.17

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0312 is similar to CT101, a hypothetical protein (basic): residues 6-141 are 33% similar to residues 7-142 of CT101.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MARNIKYFLILFPGILWISAGMKLLLKATAIALDPLSSFFTYCLLSMVSW
GLASLKHRYLLSKTIRKQLSLSSEFFSQKITWIAYIKQTFISRRFLIMVI
MIAFSLVLRRYISNPQALFVIRATVGYALIKTAIAYFSKLQNALMENPEG
N$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAGAAACATCAAATATTTCCTGATACTATTTCCTGGTATTTTGTG
GATATCAGCAGGAATGAAACTCTTGCTAAAAGCTACCGCAATAGCCCTAG
ACCCCCTTTCTTCTTTTTTTACCTACTGTCTTCTATCTATGGTTTCTTGG
GGATTAGCATCCCTAAAACATCGCTACTTGCTAAGCAAAACTATAAGGAA
ACAGCTGAGTCTATCTTCTGAATTCTTTTCACAAAAAATTACATGGATTG
CCTATATAAAGCAGACCTTTATCTCTAGAAGGTTTCTCATCATGGTCATT
ATGATTGCCTTCTCTTTAGTCCTTCGTCGTTATATCAGCAATCCTCAAGC
CTTATTCGTGATTCGAGCTACAGTGGGCTATGCTCTCATTAAAACTGCCA
TCGCTTACTTCTCAAAATTACAGAATGCCCTAATGGAAAATCCTGAAGGA
AATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy