Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR259 IGR262 IGR258 IGR256 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0308 acpS, - CPn0313 CPn0312 nusA, - CPn0316 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0308 acpS, - CPn0313 CPn0312 nusA, - CPn0316 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 CPn0308 CPn0312 nusA, - CPn0316 rs1, - CPn0315 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0311

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lgt  umpA  

Definition:
prolipoprotein diacylglyceryl transferase

Gene Start:
354438

Gene Stop:
353572

Gene Length:
867

Molecular Weight*:
32852

pI*:
10.10

Net Charge*:
11.91

EC:
 

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:
In E.coli, the LGT enzyme catalyzes the first step
in lipid biosynthesis: an N-acyl diglyceride group is transferred to the
N-terminal cysteine of membrane lipoproteins.

Blast Summary:  PSI-Blast Search
CPn0310 is similar to TP0852 in T. pallidum, UU075 in U. urealyticum and MG086 in M. genitalium. They are all predicted prolipoprotein diacylglyceryl transferases.

CPn0311 is orthologously related to CT252: residues 3-280 are 51% similar to residues 1-271 of CT252.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0682
COG name: Prolipoprotein diacylglyceryltransferase
Functional Class:  M
The phylogenetic pattern of COG0682 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 280 (E-value = 4.1e-94) place CPn0311 in the LGT family which is described as Prolipoprotein diacylglyceryl transferase (PF01790)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
44
transmembrane  
67  
88
transmembrane  
112  
130
transmembrane  
140  
157
transmembrane  
195  
212
transmembrane  
223  
240
transmembrane  
259  
276

PDB Hit:


Gene Protein Sequence:
MAVIYWDRSKIVWSFEPWSLRLTWYGVFFTVGIFLACLSARYLALSYYGL
KDHLSFSKSQLRVALENFFIYSILFIVPGARLAYVIFYGWSFYLQHPEEI
IQIWHGGLSSHGGVLGFLLWAAIFSWIYKKKISKLTFLFLTDLCGSVFGI
AAFFIRLGNFWNQEIVGTPTSLPWGVVFSDPMQGVQGVPVHPVQLYEGIS
YLVVSGILYFLSYKRYLHLGKGYVTSIACISVAFIRFFAEYVKSHQGKVL
AEDCLLTIGQILSIPLFLFGVALLIICSLKARRHRSHI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTGATCTATTGGGATCGCTCAAAAATTGTCTGGTCTTTCGAGCC
ATGGTCTCTAAGACTTACTTGGTATGGCGTCTTTTTTACTGTAGGGATTT
TTCTAGCATGTCTCTCAGCAAGGTATTTGGCTCTTTCCTATTATGGTTTG
AAAGATCATTTAAGTTTTTCCAAAAGCCAGCTACGCGTGGCTTTAGAAAA
CTTTTTTATATACTCTATTTTATTTATTGTCCCTGGAGCTAGACTTGCCT
ATGTGATTTTTTATGGATGGAGTTTTTACTTACAACATCCTGAAGAGATC
ATTCAAATATGGCACGGAGGCTTGTCGAGTCATGGAGGCGTTCTTGGCTT
TCTTTTGTGGGCGGCCATTTTTTCTTGGATATATAAAAAAAAGATTTCAA
AATTGACTTTTCTCTTCCTTACAGACTTGTGTGGATCAGTTTTCGGAATT
GCAGCGTTTTTTATTCGTTTGGGTAATTTTTGGAATCAAGAAATTGTAGG
AACACCGACTTCTTTGCCTTGGGGGGTGGTTTTTTCTGATCCTATGCAAG
GTGTCCAGGGAGTTCCTGTGCATCCTGTGCAGCTTTATGAGGGAATCAGT
TACTTGGTCGTCTCTGGAATTTTATATTTTCTTTCCTATAAGCGTTATTT
GCATTTAGGTAAGGGATATGTGACTTCTATAGCCTGTATTTCTGTCGCTT
TCATTCGTTTTTTTGCGGAGTATGTAAAAAGCCATCAAGGGAAAGTTTTA
GCAGAGGATTGTCTACTTACAATTGGTCAAATTTTATCTATACCTTTATT
TCTATTTGGTGTGGCCTTACTTATCATTTGCTCATTGAAAGCTCGAAGGC
ACCGTTCACACATATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy