Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR259 IGR258 IGR256 IGR261 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 acpS, - CPn0313 CPn0312 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 acpS, - CPn0313 CPn0312 rs1, - CPn0315 lgt,umpA, - CPn0311 trxB, - CPn0314 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 CPn0312 rs1, - CPn0315 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0310

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
60 kDa inner membrane protein

Gene Start:
353433

Gene Stop:
351046

Gene Length:
2388

Molecular Weight*:
89327

pI*:
9.90

Net Charge*:
15.99

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0310 is similar to TP0949, a predicted 60 kDa inner membrane protein homolog in T. pallidum:residues 512-766 are 32% similar to TP0949.

CPn0310 is orthologously related to CT251 and they share 62% similarity.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0706
COG name: Inner membrane proteins, SpoIIIJ family
Functional Class:  S
The phylogenetic pattern of COG0706 is ----yqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 574 to 779 (E-value = 1.7e-100) place CPn0310 in the 60KD_IMP family which is described as 60Kd inner membrane protein (PF02096)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
15
non-globular  
544  
615

PDB Hit:


Gene Protein Sequence:
MNKRTLLFVSLIGIAFVGCQIFFGYNEFRSCKNLAEKQRKISEQTLAAVE
SVGLSVASWDTDVNGEEHKNNYAVRVGDKLFLLHNGEAAQSVYSSGESWS
FVDHKCGFDNIHLALYRQQGSSFNPTNTGKVFLPTNHEGLPVLVVEFRNN
KEPLVFLGEYAQGRISNKDSTIFGTALVFWRSGSDYIPLGLYDSREEKLV
SLDLPITRAVIFGNDQDSAKSSDTANHYVLFNDYMQIIVSEESGSIEGIN
LPFASTNNKSIVNEIGFDRDLASEKSPEALFPGLSSKLPDGQQAKNSIGG
YYPLLRRGLLSDSKKLLPLEYHALNVVSGRELATPVALRYRVLSYTPHSI
QLESLDRSVQKVYKLPENPEEKPYVFETAITLTKETEDVWVTSGVPEVEI
MSNASAPTIKYRVIKKNKGSLDKVKLPKVKEPLAIRRGVYPQWILNSNGY
FGIILTPLSEIASGYGSLYISGSTAPTRLSAISPKNQLYPVSKYPGYETL
LPLPKDAGTHRFLVYAGPLAEPTLKVLDKTITQEKGENPEYLDSISFRGV
FAFITAPFAALLFIIMKFFKLVTGSWGISIILLTVFLKLLLYPLNAWSIR
SMRRMQILSPYIQQIQQKYKNEPKRAQMEIMGLYKTNKVNPITGCLPLLI
QLPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDVLFSWQTSIWFIGNE
FHLLPILLGIVMFLQQKVTSLHKKGPVTDQQKQQQVMGNMMAILFTAMFY
NFPSGLNIYWLSSMILGVVQQWITNKILDSKHLKNEVVLNNKKHR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAACGCACTTTGCTTTTTGTTTCTTTAATTGGGATTGCTTTTGT
AGGATGTCAAATATTTTTTGGTTATAATGAATTTCGTTCCTGCAAAAATC
TAGCAGAGAAACAAAGAAAGATTTCAGAACAGACGCTAGCTGCAGTAGAA
TCTGTAGGGTTAAGTGTAGCTTCATGGGACACCGATGTAAACGGAGAAGA
ACATAAGAATAACTACGCAGTTCGTGTTGGAGACAAGTTATTTTTATTAC
ATAATGGAGAAGCTGCTCAGTCTGTTTATTCTTCTGGGGAATCTTGGAGC
TTTGTAGATCACAAGTGTGGTTTCGATAATATTCACTTGGCTTTATATCG
TCAGCAGGGTTCTTCTTTCAATCCTACGAATACGGGAAAAGTTTTTCTTC
CTACGAATCATGAAGGTTTACCTGTACTAGTTGTTGAGTTTCGTAACAAT
AAAGAGCCTTTAGTATTTCTAGGTGAGTACGCACAAGGAAGAATTTCCAA
TAAAGATAGCACGATCTTTGGTACAGCGCTTGTCTTTTGGAGATCAGGAA
GCGACTATATTCCTTTAGGTCTCTATGATTCTCGAGAAGAAAAGTTAGTT
TCTTTGGATCTTCCTATTACACGAGCTGTAATTTTTGGTAATGACCAAGA
TTCGGCAAAGTCGTCAGATACTGCGAACCACTATGTTTTATTTAATGATT
ACATGCAGATTATTGTTTCTGAAGAGAGTGGTTCTATAGAAGGTATCAAT
TTACCTTTTGCTTCAACAAATAATAAAAGCATTGTGAATGAAATTGGTTT
TGATAGGGATTTAGCTTCAGAGAAATCTCCTGAAGCTCTTTTCCCTGGGC
TGTCTTCAAAACTTCCTGATGGCCAACAAGCCAAAAACTCGATTGGAGGT
TACTACCCTTTATTGCGCAGGGGATTATTAAGTGATTCTAAGAAATTACT
TCCTCTAGAGTATCACGCATTAAATGTGGTTTCAGGAAGAGAGCTAGCGA
CTCCTGTGGCTTTAAGATACCGAGTTCTTTCCTATACCCCCCATTCCATT
CAATTGGAAAGCTTAGATAGATCGGTTCAGAAGGTATACAAACTTCCAGA
GAATCCGGAAGAAAAGCCCTATGTTTTTGAAACTGCAATTACTTTAACGA
AAGAAACCGAAGATGTATGGGTAACTTCAGGAGTTCCTGAAGTGGAGATC
ATGTCAAATGCTTCAGCCCCAACCATTAAATACAGGGTTATCAAAAAAAA
TAAGGGGTCTTTAGATAAAGTTAAGCTTCCAAAAGTAAAAGAGCCTTTAG
CTATACGTCGTGGTGTTTATCCTCAATGGATTTTAAATTCGAATGGATAT
TTCGGTATTATTTTAACTCCGTTGTCTGAAATTGCTTCTGGCTATGGATC
TCTCTACATTTCGGGTTCTACGGCTCCGACAAGATTGTCTGCTATTTCTC
CTAAAAATCAACTGTATCCAGTATCAAAATATCCTGGATATGAGACCTTG
CTTCCTTTGCCAAAAGATGCAGGGACACATCGATTTTTAGTGTATGCAGG
TCCCTTGGCAGAGCCTACACTTAAAGTATTAGATAAGACAATTACTCAGG
AGAAGGGAGAAAATCCTGAGTATCTTGATAGCATTTCTTTCCGTGGTGTT
TTTGCATTTATTACAGCTCCTTTTGCAGCACTCCTATTTATTATTATGAA
GTTCTTCAAATTGGTTACGGGTTCTTGGGGAATTTCCATTATTTTACTTA
CTGTATTTTTGAAATTGCTTCTCTATCCTTTAAATGCATGGTCCATACGA
TCTATGAGGCGTATGCAGATTTTATCTCCTTATATTCAGCAAATTCAGCA
AAAGTATAAGAACGAACCTAAGCGTGCTCAGATGGAAATCATGGGCTTGT
ATAAGACAAACAAAGTGAATCCTATCACGGGTTGTTTACCTTTATTGATA
CAGCTTCCTTTCCTAATTGCGATGTTTGATTTATTAAAGTCATCATTCTT
ATTACGAGGAGCCTCGTTTATTCCTGGGTGGATTGATAACTTAACAGCTC
CTGATGTGTTGTTTTCTTGGCAGACATCGATATGGTTTATTGGAAATGAG
TTCCACTTACTTCCTATTCTATTAGGTATAGTGATGTTCTTACAACAGAA
GGTCACGAGTTTGCATAAGAAAGGACCTGTTACGGATCAGCAGAAACAGC
AACAAGTTATGGGGAACATGATGGCGATTTTATTTACCGCTATGTTCTAT
AACTTCCCTTCAGGATTAAACATCTATTGGCTTTCGTCTATGATTTTAGG
AGTCGTCCAGCAGTGGATCACTAATAAGATATTAGATAGCAAACATCTTA
AAAATGAAGTGGTTTTAAATAATAAAAAACATCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy