Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR260 IGR257 IGR255 IGR259 IGR258 IGR256 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 acpS, - CPn0313 CPn0312 pdhC,aceF, - CPn0306 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 acpS, - CPn0313 CPn0312 pdhC,aceF, - CPn0306 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 CPn0312 pdhC,aceF, - CPn0306 acpS, - CPn0313
* Calculated from Protein Sequence

Gene ID: CPn0309

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaA  

Definition:
DnaA replication protein

Gene Start:
350974

Gene Stop:
349592

Gene Length:
1383

Molecular Weight*:
52930

pI*:
6.90

Net Charge*:
-0.49

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
In E. coli, the DNAA protein binds to the origin
of replication as well as
to ATP and acidic phospholipids. The 9-nt
consensus for binding to DNA
is 5'-TTATC(C/A)A(C/A)A-3'.

Blast Summary:  PSI-Blast Search
CPn0309 is similar to TP0001 in T. pallidum, MG469 in M. genitalium and UU001 in U. urealyticum. They are all predicted chromosal resplication initiator proteins.

CPn0309 is orthologously related to CT250 and CT275, both predicted dnaA DNAA replication proteins. Residues 1-452 are 72% similar to CT250. CPn0309 is also similar to CT275, a predicted DnaA replication protein.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0593
COG name: ATPase involved in DNA replication initiation
Functional Class:  L
The phylogenetic pattern of COG0593 is -----qvcEbrHujgpolINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0309 is paralogously related to CPn0424, a predicted replication factor: residues 4-428 are 25% similar to CPn0424.

Pfam Summary:  Pfam Search
Residues 104 to 421 (E-value = 1.1e-77) place CPn0309 in the Bac_DnaA family which is described as Bacterial dnaA protein (PF00308)

PDB Hit:


Gene Protein Sequence:
MRAWEEFLLLQEKEIGTNTVDKWLRSLKVLCFDACNLYLEAQDSFQITWF
EEHIRHKVKSGLVNNNNKPIRVHVTSVDKAAPFYKEKQMQQEKTAYFTMH
YGSVNPEMTFSNFLVTPENDLPFRVLQEFTKSPDENGGVTFNPIYLFGPE
GSGKTHLMQSAISVLRESGGKILYVSSDLFTEHLVSAIRSGEMQKFRSFY
RNIDALFIEDIEVFSGKSATQEEFFHTFNSLHSEGKLIVVSSSYAPVDLV
AVEDRLISRFEWGVAIPIHPLVQEGLRSFLMRQVERLSIRIQETALDFLI
YALSSNVKTLLHALNLLAKRVMYKKLSHQLLYEDDVKTLLKDVLEAAGSV
RLTPLKIIRNVAQYYGVSQESILGRSQSREYVLPRQVAMYFCRQKLSLSY
VRIGDVFSRDHSTVISSIRLIEQKIEENSHDIHMAIQDISKNLNSLHKSL
EFFPSEEMII$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAGCATGGGAAGAATTTCTTTTGCTACAAGAGAAAGAAATTGGCAC
AAATACTGTAGACAAGTGGTTGCGATCTTTAAAGGTCTTATGTTTTGATG
CTTGTAATTTGTATCTTGAAGCTCAAGATTCTTTTCAAATTACTTGGTTT
GAGGAGCATATAAGACATAAGGTTAAATCTGGTCTTGTAAATAATAACAA
TAAGCCCATTCGTGTTCACGTTACTTCGGTAGATAAAGCAGCTCCTTTTT
ATAAGGAGAAGCAGATGCAGCAAGAGAAGACAGCATACTTTACCATGCAT
TATGGAAGTGTGAATCCTGAGATGACCTTCTCTAATTTTTTAGTTACCCC
TGAAAATGATCTTCCTTTTCGTGTTTTACAGGAATTTACTAAGAGTCCTG
ATGAAAACGGAGGAGTTACTTTTAATCCAATTTATCTGTTTGGACCTGAG
GGATCTGGAAAAACTCACTTAATGCAGTCAGCTATCAGTGTTCTTCGTGA
ATCTGGAGGTAAGATTCTCTATGTTTCTTCGGATTTGTTTACAGAGCACT
TAGTCTCTGCTATCCGTTCAGGAGAAATGCAAAAATTCCGTTCTTTTTAC
CGCAATATTGATGCTCTATTCATTGAGGATATCGAGGTTTTTTCAGGAAA
GTCGGCAACTCAAGAAGAGTTCTTCCATACGTTTAATTCTCTTCATTCTG
AAGGGAAGTTGATTGTAGTGTCTTCATCCTATGCGCCTGTGGATCTCGTT
GCTGTTGAAGATAGATTGATCAGCAGGTTTGAATGGGGAGTTGCAATTCC
GATACATCCTTTGGTTCAGGAAGGATTGCGCAGTTTCTTAATGAGACAGG
TAGAGCGCTTATCTATTCGCATTCAAGAAACGGCCTTAGATTTTTTAATT
TATGCGCTATCTTCCAACGTAAAGACCTTACTGCATGCACTGAATCTTTT
AGCAAAGAGGGTAATGTATAAAAAACTCTCTCACCAATTACTATATGAAG
ATGATGTGAAAACTCTTTTAAAAGATGTTTTAGAAGCAGCAGGAAGCGTT
CGTTTAACTCCTTTAAAGATTATTCGTAATGTTGCTCAATATTATGGGGT
CTCTCAGGAGAGTATTTTAGGACGTTCTCAGTCCCGAGAATATGTATTGC
CACGTCAGGTAGCCATGTACTTTTGTCGTCAGAAGCTTTCACTATCATAC
GTGAGAATAGGCGATGTCTTTTCAAGAGATCATTCGACGGTAATCTCATC
CATACGATTGATTGAACAAAAAATAGAAGAAAATAGCCATGATATTCACA
TGGCTATTCAAGATATTTCTAAGAATTTAAATTCCTTGCATAAGAGTTTG
GAATTTTTCCCTAGCGAAGAGATGATTATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy