Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR257 IGR255 IGR258 IGR256 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhB,odpB, - CPn0305 pdhC,aceF, - CPn0306 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhB,odpB, - CPn0305 pdhC,aceF, - CPn0306 lgt,umpA, - CPn0311 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhB,odpB, - CPn0305 pdhC,aceF, - CPn0306
* Calculated from Protein Sequence

Gene ID: CPn0308

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
349234

Gene Stop:
349599

Gene Length:
366

Molecular Weight*:
12971

pI*:
11.10

Net Charge*:
8.65

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
GenBank describes this sequence as having similarity to CT249, but such is not observed using BLAST. What
is the basis for the assertion?

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
35  
80

PDB Hit:


Gene Protein Sequence:
MATVAQTPQTTQPQPSVSHKATHRYCSWVFFKPILVSLGLLLASLTTLGL
VIASGVTLSLGIGIVLAIQIVLAGIALVLAFNHIRQFKQARTAELNSMKM
ISAPAAATVQKQKLEDRYSSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTACAGTAGCACAAACACCTCAGACTACACAACCACAACCATCAGT
ATCTCACAAGGCAACACATCGTTATTGTTCCTGGGTATTTTTTAAGCCTA
TTTTAGTTAGTCTAGGTCTCCTCCTTGCTTCCTTAACCACCCTAGGACTG
GTTATTGCCAGTGGAGTCACCCTATCCTTAGGAATCGGCATTGTTCTTGC
TATACAGATAGTACTTGCTGGTATTGCTCTTGTCCTTGCTTTCAATCATA
TTAGACAATTTAAACAAGCTAGAACAGCGGAGTTGAACTCAATGAAAATG
ATATCTGCGCCGGCTGCTGCAACTGTCCAGAAGCAAAAATTAGAGGATCG
TTACTCCTCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy