Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR257 IGR255 IGR253 IGR256 CPn0303 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 pdhC,aceF, - CPn0306 CPn0303 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 pdhC,aceF, - CPn0306 CPn0303 dnaA, - CPn0309 CPn0310 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 pdhC,aceF, - CPn0306 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305
* Calculated from Protein Sequence

Gene ID: CPn0307

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgP  

Definition:
alpha glycan phosphorylase

Gene Start:
348986

Gene Stop:
346512

Gene Length:
2475

Molecular Weight*:
94480

pI*:
6.20

Net Charge*:
-9.72

EC:
2.4.1.1  

Functional Class:

Pathway: pathway table
Starch and sucrose metabolism

Comment:
In E. coli, this enzyme converts 1,4-alpha-D-glucosyl-(N) + orthophosphate to 1,4-alpha-D-glucosyl (N-1) + alpha-D-glucose 1 phosphate.

From Prosite PDOC00095.

Phosphorylases (EC 2.4.1.1) are important allosteric enzymes in carbohydrate metabolism. They catalyze the formation of glucose 1-phosphate from polyglucose such as glycogen, starch or maltodextrin. Enzymes from different sources differ in their regulatory mechanisms and their natural substrates. However, all known phosphorylases share catalytic and structural properties. They are pyridoxal-phosphate dependent enzymes; the pyridoxal-P group is attached to a lysine residue around which the sequence is highly conserved and can be used as a signature pattern to detect this class of enzymes.


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glycogen phosphorylase sequences; e.g. residues 13-814 are 52% similar to glycogen phosphorylase (EC 2.4.1.1) - rabbit; and residues 13-817 are 51% similar to (AF001899) glycogen myophosphorylase [Ovis aries].
CPn0307 is similar to CT248, a predicted glgP alpha glycan phosphorylase. Residues 7-814 are 75% similar to CT248.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0058
COG name: Glucan phosphorylase
Functional Class:  G
The phylogenetic pattern of COG0058 is -m-kyq-CEbrh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 57-816 span ten regions of similarity to blocks BL00102A-J (Phosphorylase pyridoxal-phosphate attachment site proteins) with a combined E-value of 0.

ProDom Summary:  Protein Domain Search
Residues 470-663 are 58% similar to a defined domain of P73511_XXXXX, defined as: METABOLISM PHOSPHORYLASE GLYCOGEN TRANSFERASE GLYCOSYLTRANSFERASE CARBOHYDRATE PYRIDOXAL PHOSPHATE ALLOSTERIC ENZYME.
Residues 268-388 are 63% similar to a defined domain of PHS3_HUMAN, defined as: METABOLISM PHOSPHORYLASE GLYCOGEN TRANSFERASE GLYCOSYLTRANSFERASE CARBOHYDRATE PYRIDOXAL PHOSPHATE ALLOSTERIC ENZYME.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
VEDFSSFDKNKVSVDSMKRAILDRLYLSVVQSPESASPRDIFTAVAKTVM
EWLAKGWLKTQNGYYKNDVKRVYYLSMEFLLGRSLKSNLLNLGILDLVRK
ALKTLNYDFDHLVEMESDAGLGNGGLGRLAACYLDSMATLAVPAYGYGIR
YDYGIFDQRIVNGYQEEAPDEWLRYGNPWEICRGEYLYPVRFYGRVIHYT
DSRGKQVADLVDTQEVLAMAYDIPIPGYGNDTVNSLRLWQAQSPRGFEFS
YFNHGNYIQAIEDIALIENISRVLYPNDSITEGQELRLKQEYFLVSATIQ
DIIRRYTKTHICLDNLADKVVVQLNDTHPALGIAEMMHILVDREELPWDK
AWEMTTVIFNYTNHTILPEALERWPLDLFSKLLPRHLEIIYEINSRWLEK
VGSRYPKNDDKRRSLSIVEEGYQKRINMANLAVVGSAKVNGVSSFHSQLI
KDTLFKEFYEFFPEKFINVTNGVTPRRWIALCNPRLSKLLNETIGDRYII
DLSHLSLIRSFAEDSGFRDHWKGVKLKNKQDLTSRIYNEVGEIVDPNSLF
DCHIKRIHEYKRQLMNILRVIYVYNDLKENPNQDVVPTTVIFSGKAAPGY
VMAKLIIKLINSVADVVNQDSRVNDKLKVLFLPNYRVSMAEHIIPGTDLS
EQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGKENMFIFGL
LEEQIVQLRREYCPQTICDKNPKIRQVLDLLEQGFFNSNDKDLFKPIVHR
LLHEGDPFFVLADLESYIAAHENVNKLFKEPDSWTKISIYNTAGMGFFSS
DRAIQDYARDIWHVPTKSCSGEGN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAGATTTTTCGAGTTTTGATAAGAACAAAGTCAGTGTTGACTCTAT
GAAACGGGCGATTTTAGATCGTCTGTATTTAAGTGTTGTACAATCACCAG
AGTCCGCATCTCCTAGAGATATCTTCACAGCTGTTGCAAAAACTGTTATG
GAATGGTTGGCCAAGGGGTGGCTGAAAACTCAAAATGGCTACTATAAAAA
TGATGTAAAAAGAGTTTATTACCTTTCCATGGAATTTCTCTTAGGGAGAA
GTCTAAAAAGCAATCTTTTGAATTTAGGAATTCTAGATTTAGTAAGGAAG
GCACTAAAAACTTTAAATTATGACTTTGACCACCTTGTAGAAATGGAATC
CGATGCAGGATTAGGAAATGGTGGTTTGGGGAGACTGGCAGCTTGTTACT
TGGATTCTATGGCTACATTAGCAGTTCCAGCCTACGGCTACGGTATACGC
TATGATTATGGTATTTTTGATCAGAGGATCGTCAACGGGTATCAAGAGGA
AGCTCCTGACGAGTGGCTACGTTATGGAAATCCTTGGGAAATCTGTAGGG
GAGAGTACCTCTATCCCGTACGATTTTATGGAAGGGTCATTCATTATACC
GATTCTCGAGGGAAACAGGTGGCAGATCTTGTCGATACCCAAGAGGTATT
GGCGATGGCTTATGATATTCCGATTCCTGGGTACGGTAATGATACTGTAA
ATTCTCTAAGGCTATGGCAAGCACAATCTCCGCGAGGCTTTGAATTCAGC
TATTTTAACCACGGGAACTATATCCAGGCTATAGAAGATATCGCCTTGAT
AGAAAACATCTCTCGCGTCCTCTATCCTAATGATTCTATTACTGAGGGGC
AGGAATTGCGTCTCAAACAAGAGTATTTTTTAGTTTCAGCAACCATTCAA
GATATTATCCGCAGATATACAAAGACACATATTTGTTTGGATAACCTTGC
GGATAAAGTCGTAGTACAATTAAACGATACCCATCCCGCTTTAGGGATTG
CTGAAATGATGCATATTTTAGTCGATAGGGAAGAATTACCTTGGGATAAG
GCTTGGGAGATGACTACAGTCATCTTTAACTATACCAATCATACAATCCT
CCCAGAGGCTTTAGAGAGATGGCCTCTCGATTTATTCTCTAAGTTATTAC
CTCGGCATTTAGAGATTATTTATGAAATAAATTCCCGTTGGTTAGAAAAA
GTTGGCTCTCGCTATCCTAAAAATGATGATAAGCGCCGGTCTTTATCCAT
TGTTGAAGAAGGGTATCAAAAGCGTATCAATATGGCAAACCTTGCCGTAG
TAGGTTCTGCAAAAGTAAATGGAGTTTCGTCATTCCACTCTCAGCTGATT
AAAGATACTCTCTTTAAAGAGTTTTATGAGTTTTTCCCTGAGAAGTTTAT
CAATGTGACCAATGGGGTGACTCCACGACGATGGATTGCTCTCTGTAATC
CTCGTTTGAGTAAGCTTCTCAATGAAACTATAGGGGATCGTTATATCATT
GATCTTTCTCATCTTTCATTGATCCGTTCCTTTGCCGAAGATAGTGGTTT
CCGAGATCATTGGAAAGGGGTAAAATTAAAAAATAAGCAGGATCTAACAA
GTAGAATTTATAATGAAGTTGGAGAAATAGTAGACCCTAATTCTCTCTTT
GACTGTCATATTAAGCGTATTCATGAGTATAAACGACAACTAATGAATAT
TCTTAGAGTCATCTATGTTTATAATGACTTGAAAGAAAACCCTAATCAAG
ATGTCGTCCCTACAACAGTAATTTTTTCTGGTAAGGCGGCTCCTGGCTAT
GTCATGGCCAAACTCATTATCAAGTTAATCAATAGCGTTGCTGACGTTGT
AAATCAAGATTCTCGAGTTAATGATAAGCTTAAGGTTCTTTTTTTACCTA
ACTATCGAGTTTCTATGGCTGAGCATATCATTCCTGGTACAGATCTTTCA
GAACAGATTTCTACAGCTGGAATGGAGGCTTCTGGAACAGGAAATATGAA
ATTTGCTTTGAATGGAGCTCTGACTATAGGAACTATGGACGGTGCAAATA
TAGAAATGGCAGAGCATATTGGTAAGGAGAATATGTTTATTTTTGGTCTT
TTGGAGGAGCAAATTGTACAACTGCGGAGGGAATACTGTCCTCAGACAAT
TTGTGATAAGAATCCTAAGATCCGTCAGGTTTTAGATTTGCTAGAACAGG
GATTTTTCAATAGCAATGATAAAGATCTGTTTAAACCGATAGTACATCGC
CTACTGCATGAAGGAGATCCCTTTTTTGTCTTGGCTGACTTGGAGTCTTA
TATCGCTGCCCATGAAAATGTGAACAAACTCTTTAAGGAACCAGATTCAT
GGACTAAGATTTCTATTTATAATACTGCAGGAATGGGCTTTTTCTCTAGT
GACAGAGCCATTCAGGATTATGCCAGAGATATTTGGCATGTTCCTACAAA
ATCTTGCTCTGGAGAAGGAAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy