Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR252 IGR255 IGR253 IGR256 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305
* Calculated from Protein Sequence

Gene ID: CPn0306

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdhC  aceF  

Definition:
pyruvate dehydrogenase E2 component(dihydrolipoamide acetyltransferase)

Gene Start:
345145

Gene Stop:
346434

Gene Length:
1290

Molecular Weight*:
46212

pI*:
6.20

Net Charge*:
-3.52

EC:
2.3.1.12  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Carbohydrate Metabolism; Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0306 is similar to MG272 in M. genitalium.

CPn0306 is orthologously related to CT247, a
predicted pyruvate dehydrogenase E2 component
(dihydrolipoamide acetyltansferase) and they
share 71% similarity. CPn0306 is also similar
to CT400, and CT055, both predicted dihydrolipoamide
succinyltransferases.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0508
COG name: Dihydrolipoamide acyltransferases
Functional Class: C
The phylogenetic pattern of COG0508 is ----Y--cEBRH--gp--INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0306 is similar to CPn0527 and CPn0377, both
predicted dihydrolipoamide succinyltransferases:
residues 6-422 are 26% similar to residues 6-389
of CPn0527 and residues 207-427 are 37% similar
to residues 139-362 of CPn0377.

Pfam Summary:  Pfam Search
Residues 3 to 76 (E-value = 1.1e-18) place CPn0306 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)
Residues 148 to 184 (E-value = 2.2e-18) place CPn0306 in the E3_binding family which is described as e3 binding domain (PF02817)
Residues 201 to 428 (E-value = 4.6e-106) place CPn0306 in the 2-oxoacid_dh family which is described as 2-oxoacid dehydrogenases acyltransferase (catalytic domain) (PF00198)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
71  
158

PDB Hit:


Gene Protein Sequence:
VISLLKMPKLSPTMEVGTIVKWHKKSNDQVSFGDVIVEISTDKAILEHTA
NEDGWIREILRHEGEKIVIGTPIAVLSTEANEPFNLEELLPKTEPSNLEA
SPKGSSEEVSPATTPQAASATFTAVTFKPEPPLSSPLVFKHVGTTNNLSP
LARQLAKEKNIDVSSIQGSGPGGRIVKKDLEKAPPKSIAGFGYPESPEVP
PGSYHEENLSPIREVIAARLQAAKISIPHFYVRQQVYASPLLNLLKELQA
QGIKLSINDCIVRACALALKEFPSINSGFNSVDNKIVRFDTIDISIAVAI
PDGIITPIIRCADRKNLGMISAEIKSLALKARNQSLQDTEYKGGSFCVSN
LGMTGITEFTAIVNPPQAAILAVGSVTEQALVLDGEITIGSTCNLTLSVD
HRVIDGYPAAMFMKRLQKILEAPAVLLLN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATCTCCTTATTGAAAATGCCAAAGCTTTCTCCAACTATGGAAGTGGG
CACTATAGTGAAATGGCATAAAAAAAGTAATGATCAGGTCAGTTTTGGAG
ACGTCATTGTAGAGATCTCTACAGACAAAGCTATTTTAGAACATACAGCA
AATGAAGATGGCTGGATTCGTGAAATCTTACGTCATGAAGGCGAGAAAAT
CGTTATAGGCACCCCTATTGCGGTACTCTCTACAGAAGCCAACGAGCCCT
TTAATCTAGAAGAACTTCTTCCTAAGACAGAACCTTCTAACCTTGAAGCA
TCTCCAAAAGGTTCTTCTGAAGAGGTCTCGCCTGCAACAACTCCACAAGC
TGCCTCAGCAACATTCACAGCAGTAACTTTTAAGCCAGAGCCACCTCTCT
CCTCGCCTTTAGTCTTCAAACACGTAGGCACTACGAATAATCTCTCTCCA
TTAGCTAGACAACTAGCAAAAGAGAAAAACATAGATGTCTCATCAATTCA
AGGGAGTGGTCCTGGAGGACGTATAGTAAAAAAAGATTTAGAGAAAGCTC
CTCCTAAAAGCATTGCTGGTTTTGGCTATCCTGAGTCTCCCGAAGTGCCT
CCAGGTTCCTATCATGAGGAGAATCTCTCTCCGATTCGGGAAGTGATTGC
TGCACGCCTACAAGCTGCTAAGATCTCTATTCCTCACTTCTATGTAAGGC
AGCAGGTCTACGCCTCACCTCTCCTTAATCTGCTCAAAGAACTTCAAGCT
CAGGGAATCAAACTCTCTATTAACGATTGCATTGTACGTGCCTGTGCTCT
GGCGCTCAAAGAGTTCCCTTCTATCAATTCAGGATTTAACAGTGTCGATA
ATAAAATCGTCCGTTTTGATACTATCGATATCTCGATAGCTGTGGCCATT
CCAGATGGAATTATTACGCCAATTATACGCTGCGCAGACCGTAAAAATCT
CGGCATGATTTCAGCAGAAATTAAGAGCTTAGCGTTAAAAGCAAGAAATC
AATCTCTTCAAGACACTGAATACAAAGGAGGGTCCTTCTGTGTCTCTAAC
TTAGGAATGACAGGAATCACTGAATTTACAGCGATTGTCAATCCTCCTCA
AGCGGCGATTCTTGCCGTAGGAAGTGTTACAGAACAAGCTCTTGTTCTTG
ACGGAGAAATTACTATAGGATCTACCTGCAATCTTACCCTATCTGTAGAT
CATAGAGTGATTGATGGTTATCCTGCTGCGATGTTTATGAAACGATTACA
AAAGATCTTAGAAGCTCCGGCTGTCCTACTATTAAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy