Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR251 IGR252 IGR255 IGR250 IGR253 IGR256 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 dnaA, - CPn0309 glgP, - CPn0307 CPn0308 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305 CPn0301
* Calculated from Protein Sequence

Gene ID: CPn0305

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdhB  odpB  

Definition:
pyruvate dehydrogenase E1 subunit beta

Gene Start:
344154

Gene Stop:
345140

Gene Length:
987

Molecular Weight*:
36302

pI*:
6.70

Net Charge*:
-1.34

EC:
1.2.4.1  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Carbohydrate Metabolism; Pyruvate metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0305 is similar to MG273 in M. genitalium
and TP0824 in T. pallidum.

CPn0305 is orthologously related to CT246:
residues 1-328 are 81% similar to that of CT246.
CPn0305 is also similar to CT340, a predicted
2-oxosiovalerate dehydrogenase alpha and beta subunit.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0022
COG name: Thiamine pyrophosphate-dependent dehydrogenases, E1 component beta subunit
Functional Class: C
The phylogenetic pattern of COG0022 is ----y--c-Br---gp--INx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0305 is paralogously related to CPn0033, a
predicted (pyruvate) oxoisovalerate dehydrogenase
alpha and beta subunit: residues 9-326 are 38%
similar to residues 353-675 of CPn0033.

Pfam Summary:  Pfam Search
Residues 7 to 183 (E-value = 4.8e-74) place CPn0305 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 196 to 319 (E-value = 8.1e-54) place CPn0305 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
58  
75
transmembrane  
80  
97
transmembrane  
138  
155
transmembrane  
266  
283

PDB Hit:


Gene Protein Sequence:
MPKHKTLEIREALREAIDEEMSRDPNVCILGEEVGDYNGAYKVTKGLLDK
WGPKRVIDAPISEAAFSGIGIGAALSGLRPIIEFMSWNFSFVALDQIISH
AAKMHFMTGGKFSVPIVFRGPNGAAAQVSCQHSHCVESLYANIPGLIIIA
PSNPYDAKGLLKSAIRNNNPVLFLENELEYNLKGEVPTEEYLVPIGKAHR
VQEGNDLTIITYSRMVSITKEACSLAKKRWGLSIEIIDLRTIKPLDISTI
LSSVRKTSRCIVIEEGHYFAGISSEIIALITEHVFDSLDAPPLRVCQKET
PMPYSKILEQATLPNVNRILDTIEKVMR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTAAACATAAAACATTAGAAATTCGAGAAGCTCTCCGAGAAGCAAT
TGACGAAGAGATGTCTCGCGATCCTAATGTCTGTATTCTTGGTGAAGAGG
TTGGTGACTACAATGGTGCTTATAAAGTCACCAAAGGCTTATTAGATAAA
TGGGGCCCTAAGAGAGTCATTGATGCTCCTATTAGTGAAGCAGCCTTCTC
TGGAATTGGAATAGGAGCCGCATTGTCAGGCCTGCGCCCTATTATAGAAT
TTATGAGCTGGAACTTTTCCTTTGTAGCCTTGGACCAAATCATTTCTCAT
GCAGCTAAGATGCATTTTATGACTGGAGGGAAGTTTTCCGTTCCTATAGT
TTTTCGTGGCCCTAATGGTGCTGCAGCCCAGGTATCTTGCCAGCATTCTC
ATTGCGTTGAGTCGTTGTATGCTAATATTCCAGGTCTTATTATTATAGCC
CCTTCGAACCCTTACGACGCTAAAGGCTTATTAAAATCAGCAATCAGAAA
TAATAACCCCGTTCTTTTTTTAGAAAACGAGCTAGAATATAACTTAAAAG
GGGAAGTCCCCACCGAAGAATATCTCGTTCCTATTGGGAAAGCACATAGA
GTTCAAGAAGGAAATGACCTTACAATTATTACTTATAGCCGTATGGTTTC
CATTACAAAAGAAGCGTGTTCTCTAGCCAAAAAACGTTGGGGCTTGTCTA
TAGAAATTATTGATCTAAGAACGATCAAACCTTTAGACATATCAACAATT
TTATCATCGGTACGAAAAACTTCACGCTGTATTGTAATTGAAGAGGGCCA
CTACTTCGCTGGGATTTCTTCTGAAATTATTGCCCTGATTACTGAGCATG
TTTTTGATTCTCTTGATGCTCCCCCCTTAAGGGTATGCCAAAAAGAAACG
CCTATGCCCTATAGTAAAATCTTAGAACAGGCCACTTTGCCTAATGTTAA
CCGAATCTTAGATACCATTGAAAAAGTCATGAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy