Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR251 IGR252 IGR255 IGR250 IGR253 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305
* Calculated from Protein Sequence

Gene ID: CPn0304

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdhA  odpA  

Definition:
pyruvate dehydrogenase E1 subunit alpha

Gene Start:
343133

Gene Stop:
344161

Gene Length:
1029

Molecular Weight*:
37453

pI*:
5.00

Net Charge*:
-9.96

EC:
1.2.4.1  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Carbohydrate Metaboli

Comment:


Blast Summary:  PSI-Blast Search
CPn0304 is similar to MG274, a predicted
pyruvate dehydrogenase E1 alpha subunit in
M. genitalium. Residues 66-330 are 27% similar
to residues 71-331 of MG274.

CPn0304 is orthologously related to CT245:
residues 8-342 are 72% similar to residues
7-340 of CT245. CPn0304 is also similar to
CT340, a predicted 2-oxoisovalerate dehydrogenase
alpha and beta subunits.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1071
COG name: Thiamine pyrophosphate-dependent dehydrogenases, E1 component alpha subunit
Functional Class: C
The phylogenetic pattern of COG1071 is ----y--c-BR---gp--INx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0304 is similar to CPn0033, a predicted
(pyruvate) oxoisovalerate dehydrogenase alpha
and beta subunits.

Pfam Summary:  Pfam Search
Residues 36 to 334 (E-value = 9.9e-73) place CPn0304 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
84  
101
transmembrane  
133  
150

PDB Hit:


Gene Protein Sequence:
MDSSAPYNIASQGTEKSTVERILDLYGPASCIKFLKQMVLIREFEARGEE
AYLEGLVGGFYHSYAGQEAVATAAIANTGLDPWVFSSYRCHALAILLNIP
LQEIAAELLGKETGCALGRGGSMHMCGPNFPGGFGIVGGQIPLAAGAAFT
IKYQEQKNRVSLCFIGDGAVAQGVFHETLNFVSLHQLPLMLIIENNGWSM
GTSLNRAVAKQPIAESQGSSYDIRAVTVNGFDLFNSLLGFREAYRYMVDT
ESPVLVECLCSRFRGHSISDPNLYRSKEEMQCLFKKDPIVLAKDWLIRLE
VLTEEEFQNIRQECKTAVLEAFSNAKLSSDPSVTTLEEGVYA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAGTTCAGCACCTTATAATATAGCTTCTCAGGGCACAGAGAAATC
CACAGTAGAAAGGATCTTAGACCTTTACGGGCCCGCTTCCTGTATTAAAT
TTTTAAAACAGATGGTTCTGATTCGTGAATTCGAAGCCCGAGGAGAAGAA
GCCTATCTAGAAGGGCTAGTGGGTGGATTTTACCACTCTTACGCTGGCCA
AGAAGCTGTAGCAACTGCTGCAATCGCAAACACAGGACTAGATCCCTGGG
TGTTCTCTTCATACCGCTGCCACGCACTTGCGATTCTTCTCAACATTCCC
CTTCAAGAAATTGCTGCTGAACTTTTAGGGAAAGAAACTGGATGCGCTTT
AGGTCGTGGAGGATCCATGCATATGTGTGGGCCTAATTTCCCTGGAGGAT
TTGGTATTGTCGGAGGACAAATTCCCCTCGCAGCTGGAGCCGCATTTACC
ATCAAATATCAAGAACAAAAAAATAGAGTTTCTCTATGCTTTATCGGAGA
TGGTGCGGTAGCTCAAGGTGTATTCCATGAAACTCTGAACTTTGTTTCTC
TTCACCAACTCCCTCTAATGCTTATTATTGAAAATAACGGCTGGAGTATG
GGAACGTCATTAAATCGTGCTGTTGCAAAACAGCCCATAGCAGAGTCTCA
AGGAAGTTCCTACGATATCCGTGCAGTCACAGTCAATGGTTTTGATCTAT
TTAACTCTCTTTTAGGATTTAGAGAGGCTTATCGCTATATGGTTGATACC
GAATCTCCGGTTTTAGTTGAGTGTCTCTGCTCCCGATTTCGAGGGCATTC
TATATCAGATCCTAATTTATATAGATCGAAAGAAGAAATGCAGTGTTTAT
TTAAAAAAGATCCTATTGTCCTAGCTAAAGATTGGCTAATTCGATTAGAG
GTTCTGACTGAAGAGGAATTTCAAAATATACGCCAAGAATGCAAAACTGC
TGTTTTAGAAGCGTTCTCTAACGCAAAACTCTCATCAGATCCATCCGTCA
CCACATTAGAGGAAGGAGTCTATGCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy