Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR251 IGR252 IGR255 IGR250 IGR253 IGR249 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 CPn0303 glgP, - CPn0307 CPn0301 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305
* Calculated from Protein Sequence

Gene ID: CPn0303

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
342958

Gene Stop:
341918

Gene Length:
1041

Molecular Weight*:
39459

pI*:
8.30

Net Charge*:
5.61

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0303 is orthologously related to CT244, a hypothetical protein: residues 31-340 are 32% similar to residues 72-378 of CT244.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
30  
57

PDB Hit:


Gene Protein Sequence:
MDVSRKINRHTQFYVDSIDGVIKNFDHKPSEDKSRDHEELEEKLLTITKR
IVASAQEFQNRKTDSKNYYLKKTQWLPFKNEELEQTKELFAMLTSMDKKI
AQLFFYSPGCSSDWVEFTEVICHLNDSIGLGGVLLCCGLFEQQCEHVVTV
NKKLDLPLLLGTTVVNSLRYYLTYRNISLLNCQSMSELGKELGDVLKQHG
VAFTLIFKEIVDIDLLNYVKLIQGLKRSGNIQARIYDNDVPTLPSVSSSP
IALRYSLANTIRGLALHVDFSSLKFISPSILSNTEHTAKALNSGGECFIF
SNLDEFNLGMKIVMQLLRTGKISPEILNKNIMKILMIKRRVRSLYI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACGTTTCTCGTAAAATTAATCGACACACTCAGTTTTACGTGGATTC
GATAGACGGTGTCATCAAAAACTTTGATCATAAGCCTAGTGAAGATAAAT
CTCGAGATCATGAAGAATTAGAGGAAAAGCTTTTAACTATAACAAAACGT
ATTGTTGCTTCTGCTCAAGAATTTCAGAATCGTAAGACGGACTCTAAAAA
CTACTACTTAAAAAAAACTCAATGGTTGCCATTCAAAAATGAAGAGTTGG
AGCAAACTAAGGAATTGTTTGCCATGTTAACTTCGATGGATAAAAAAATA
GCTCAGTTATTTTTTTATTCTCCCGGATGTAGTAGCGACTGGGTAGAATT
TACCGAAGTAATTTGTCATTTAAATGATTCTATAGGTTTGGGAGGGGTTT
TACTGTGTTGCGGATTATTCGAACAACAGTGTGAGCATGTTGTTACTGTG
AATAAAAAGCTAGACCTACCGCTTCTTTTAGGAACTACCGTTGTAAATAG
TCTACGTTATTATTTAACCTATAGGAATATCTCTCTTTTGAATTGTCAGA
GCATGAGTGAGCTAGGCAAGGAGCTCGGGGATGTTTTAAAGCAACATGGA
GTTGCTTTCACTTTAATTTTTAAAGAGATTGTGGATATAGATTTATTAAA
CTATGTGAAACTAATTCAAGGACTCAAGCGTAGTGGAAATATTCAAGCAC
GTATTTATGATAATGATGTGCCTACTTTACCTTCAGTTTCATCGAGTCCT
ATTGCGTTGAGATATAGCTTAGCGAATACAATTCGGGGCCTTGCTTTACA
TGTAGATTTTTCTTCATTGAAGTTTATAAGCCCGTCTATACTTTCCAATA
CAGAGCACACTGCAAAAGCTTTAAACTCTGGCGGAGAATGTTTTATCTTT
TCTAATCTGGATGAATTCAATCTTGGAATGAAAATAGTCATGCAACTATT
GCGGACAGGGAAGATTAGCCCAGAAATTTTAAATAAAAATATCATGAAAA
TTCTCATGATAAAAAGAAGAGTACGTTCTTTATATATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy