Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR251 IGR252 IGR250 IGR248 IGR253 IGR249 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305
* Calculated from Protein Sequence

Gene ID: CPn0302

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
firA  lpxD  

Definition:
UDP-3-O-(R-3-hydoxymyristoyl)-glucosamine-N-acyltransferase

Gene Start:
340787

Gene Stop:
341869

Gene Length:
1083

Molecular Weight*:
38834

pI*:
8.10

Net Charge*:
5.92

EC:
2.3.1.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Comment:
The LPXD enzyme in E. coli catalyzes the third step in
lipid A (endotoxin) biosynthesis; it is reported to be
a rifampicin resistance protein in E.coli and S.typhimurium.

Blast Summary:  PSI-Blast Search
CPn0302 is orthologous to CT243, a predicted UDP-3-O-(R-3-hydoxymyristoyl)-glucosamine-N-acyltransferase:
residues 7-352 are 71% similar to CT243. CPn0302 is also weakly similar to CT531. No similarity
to T.pallidum, M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1044
COG name: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG1044 is -----q-ce--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0302 is paralogous to CPn0650, a predicted Acyl-Carrier UDP-GlcNAc O-Acyltransferase:
residues 108-314 are 27% similar to residues 4-186 of CPn0650.

Pfam Summary:  Pfam Search
Residues 7 to 110 (E-value = 9.5e-48) place CPn0302 in the LpxD family which is described as UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD (PF04613)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
210  
312

PDB Hit:


Gene Protein Sequence:
MSEAPVYTLKQLAELLQVEVQGNIETPISGVEDISQAQPHHIAFLDNEKY
SSFLKNTKAGAIILSRSQAMQHAHLKKNFLITNESPSLTFQKCIELFIEP
VTSGFPGIHPTAVIHPTARIEKNVTIEPYVVISQHAHIGSDTYIGAGSVI
GAHSVLGANCLIHPKVVIRERVLMGNRVVVQPGAVLGSCGFGYITNAFGH
HKPLKHLGYVIVGDDVEIGANTTIDRGRFKNTVIHEGTKIDNQVQVAHHV
EIGKHSIIVAQAGIAGSTKIGEHVIIGGQTGITGHISIADHVIMIAQTGV
TKSITSPGIYGGAPARPYQETHRLIAKIRNLPKTEERLSKLEKQVRDLST
PSLAEIPSEI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGAAGCACCAGTCTACACTCTTAAACAGTTAGCTGAGCTACTACA
AGTCGAAGTTCAAGGAAATATAGAAACTCCTATTTCAGGTGTTGAAGATA
TTAGTCAGGCGCAACCTCACCATATTGCTTTTTTAGATAATGAGAAATAC
TCTAGCTTTCTAAAAAACACCAAAGCTGGTGCTATTATTTTATCTAGATC
TCAGGCAATGCAACATGCCCACCTAAAGAAAAACTTTCTTATTACCAATG
AATCCCCTTCTCTAACATTTCAAAAGTGCATAGAGTTGTTTATTGAACCC
GTAACATCAGGGTTTCCTGGTATTCATCCTACTGCAGTGATTCATCCTAC
TGCACGTATTGAGAAAAATGTAACCATAGAACCTTACGTTGTCATTAGTC
AACATGCCCATATCGGCTCTGACACATACATCGGAGCTGGAAGTGTCATT
GGAGCTCACAGCGTTCTAGGTGCTAACTGTCTGATTCACCCTAAGGTGGT
GATTCGAGAAAGAGTCCTCATGGGAAACCGTGTAGTTGTTCAACCTGGAG
CTGTTTTAGGATCCTGTGGTTTTGGTTATATTACAAATGCTTTTGGTCAT
CACAAACCTTTAAAGCATCTAGGCTATGTGATTGTAGGTGATGATGTAGA
AATCGGAGCCAACACTACGATAGATCGTGGTCGATTCAAGAACACCGTGA
TCCATGAAGGAACTAAAATAGATAACCAAGTACAAGTAGCTCATCACGTA
GAAATTGGAAAGCATAGTATTATTGTTGCCCAAGCAGGCATTGCAGGTTC
TACAAAAATTGGTGAACATGTCATCATTGGAGGGCAAACCGGAATTACTG
GGCATATTTCTATTGCAGACCATGTGATCATGATTGCTCAAACTGGAGTC
ACAAAATCTATCACCTCTCCAGGCATTTATGGAGGCGCTCCAGCACGACC
TTATCAAGAAACACATCGGTTGATTGCTAAAATTCGGAACCTTCCTAAAA
CTGAAGAAAGACTAAGTAAGTTAGAAAAACAAGTAAGAGATCTATCGACT
CCCAGCCTTGCTGAGATTCCTTCAGAGATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy