Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR254 IGR247 IGR251 IGR252 IGR250 IGR248 IGR253 IGR249 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 pdhC,aceF, - CPn0306 CPn0300 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 CPn0300 pdhB,odpB, - CPn0305 pdhB,odpB, - CPn0305 pdhC,aceF, - CPn0306
* Calculated from Protein Sequence

Gene ID: CPn0301

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
OmpH-like outer membrane protein

Gene Start:
340250

Gene Stop:
340765

Gene Length:
516

Molecular Weight*:
19466

pI*:
4.80

Net Charge*:
-6.79

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0301 is orthologously related to CT242, a probable outer membrane protein: residues 1-168 are 56% similar to CT242.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 164 (E-value = 3.7e-58) place CPn0301 in the OmpH family which is described as Outer membrane protein (OmpH-like) (PF03938)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
coil-coil  
35  
147

PDB Hit:


Gene Protein Sequence:
MKKLLFSTFLLVLGSTSAAHANLGYVNLKRCLEESDLGKKETEELEAMKQ
QFVKNAEKIEEELTSIYNKLQDEDYMESLSDSASEELRKKFEDLSGEYNA
YQSQYYQSINQSNVKRIQKLIQEVKIAAESVRSKEKLEAILNEEAVLAIA
PGTDKTTEIIAILNESFKKQN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATTATTATTTTCTACATTTCTTCTTGTTTTAGGATCAACAAG
CGCAGCTCATGCAAATTTAGGCTATGTTAATTTAAAGCGATGTCTTGAAG
AATCCGATCTAGGTAAAAAGGAAACTGAAGAATTGGAAGCTATGAAACAG
CAGTTTGTAAAAAATGCTGAGAAAATAGAAGAAGAACTCACTTCTATTTA
TAATAAGTTGCAAGATGAAGATTACATGGAAAGCCTATCGGATTCTGCCT
CTGAAGAGTTGCGAAAGAAATTCGAAGATCTTTCAGGAGAGTACAATGCG
TACCAGTCTCAGTACTATCAATCTATCAATCAAAGTAATGTAAAACGCAT
TCAAAAACTCATTCAAGAAGTAAAAATAGCTGCAGAATCAGTGCGGTCCA
AAGAAAAACTAGAAGCTATCCTTAATGAAGAAGCTGTCTTAGCAATAGCA
CCTGGGACTGATAAAACAACCGAAATTATTGCTATTCTTAACGAATCTTT
CAAAAAACAAAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy