Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR251 IGR252 IGR250 IGR248 IGR245 IGR253 IGR249 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 CPn0300 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 CPn0300 Type: tandem, Name:  - 3 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0301 recR, - CPn0299 pdhA,odpA, - CPn0304 firA,lpxD, - CPn0302 CPn0300
* Calculated from Protein Sequence

Gene ID: CPn0300

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable outer membrane protein (Omp85 analog)

Gene Start:
337783

Gene Stop:
340155

Gene Length:
2373

Molecular Weight*:
88951

pI*:
8.60

Net Charge*:
8.22

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0300 is similar to TP0326, a predicted outer membrane protein: residues 75-614 are 24% similar to residues 83-594.

CPn0300 is orthologously related to CT241 and they share 69% similarity.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0729
COG name: Predicted outer membrane protein
Functional Class: M
The phylogenetic pattern of COG0729 is -----QvcE--Huj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 130 to 189 (E-value = 1.6e-09) place CPn0300 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 220 to 279 (E-value = 5.3e-08) place CPn0300 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 301 to 360 (E-value = 1.4e-07) place CPn0300 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 382 to 442 (E-value = 1.8e-07) place CPn0300 in the Surf_Ag_VNR family which is described as Surface antigen variable number repeat (PF07244)
Residues 454 to 790 (E-value = 1.3e-28) place CPn0300 in the Bac_surface_Ag family which is described as Surface antigen (PF01103)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
440  
497

PDB Hit:


Gene Protein Sequence:
MLIMRNKVILQISILALIQTPLTLFSTEKVKEGHVVVDSITIITEGENAS
NKHPLPKLKTRSGALFSQLDFDEDLRILAKEYDSVEPKVEFSEGKTNIAL
HLIAKPSIRNIHISGNQVVPEHKILKTLQIYRNDLFEREKFLKGLDDLRT
YYLKRGYFASSVDYSLEHNQEKGHIDVLIKINEGPCGKIKQLTFSGISRS
EKSDIQEFIQTKQHSTTTSWFTGAGLYHPDIVEQDSLAITNYLHNNGYAD
AIVNSHYDLDDKGNILLYMDIDRGSRYTLGHVHIQGFEVLPKRLIEKQSQ
VGPNDLYCPDKIWDGAHKIKQTYAKYGYINTNVDVLFIPHATRPIYDVTY
EVSEGSPYKVGLIKITGNTHTKSDVILHETSLFPGDTFNRLKLEDTEQRL
RNTGYFQSVSVYTVRSQLDPMGNADQYRDIFVEVKETTTGNLGLFLGFSS
LDNLFGGIELSESNFDLFGARNIFSKGFRCLRGGGEHLFLKANFGDKVTD
YTLKWTKPHFLNTPWILGIELDKSINRALSKDYAVQTYGGNVSTTYILNE
HLKYGLFYRGSQTSLHEKRKFLLGPNIDSNKGFVSAAGVNLNYDSVDSPR
TPTTGIRGGVTFEVSGLGGTYHFTKLSLNSSIYRKLTRKGILKIKGEAQF
IKPYSNTTAEGVPVSERFFLGGETTVRGYKSFIIGPKYSATEPQGGLSSL
LISEEFQYPLIRQPNISAFVFLDSGFVGLQEYKISLKDLRSSAGFGLRFD
VMNNVPVMLGFGWPFRPTETLNGEKIDVSQRFFFALGGMF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCATCATGCGAAATAAAGTTATCTTGCAAATATCTATTCTAGCGTT
AATCCAAACCCCTTTAACTTTATTTTCTACTGAAAAAGTTAAAGAAGGCC
ATGTGGTGGTAGACTCTATCACAATCATAACGGAAGGAGAAAATGCTTCA
AATAAACATCCCTTACCCAAATTAAAGACCAGAAGTGGGGCTCTTTTTTC
TCAATTAGATTTTGATGAAGACTTGAGAATTCTAGCTAAAGAATACGACT
CTGTTGAGCCTAAAGTAGAATTTTCTGAAGGGAAAACTAACATAGCCCTT
CACCTAATAGCTAAACCCTCAATTCGAAATATTCATATCTCAGGAAATCA
AGTCGTTCCTGAACATAAAATTCTTAAAACCCTACAAATTTACCGTAATG
ATCTCTTTGAACGAGAAAAATTTCTTAAGGGTCTTGATGATCTAAGAACG
TATTATCTCAAGCGAGGATATTTCGCATCCAGTGTAGACTACAGTCTGGA
ACACAATCAAGAAAAAGGTCACATCGATGTTTTAATTAAAATCAATGAAG
GTCCTTGCGGGAAAATTAAACAGCTTACGTTCTCAGGAATCTCTCGATCA
GAAAAATCAGATATCCAAGAATTTATTCAAACCAAGCAGCACTCTACAAC
TACAAGTTGGTTTACTGGAGCTGGACTCTATCACCCAGATATTGTTGAAC
AAGATAGCTTGGCAATTACGAATTACCTACATAATAACGGGTACGCTGAT
GCTATAGTCAACTCTCACTATGACCTTGACGACAAAGGGAATATTCTTCT
TTACATGGATATTGATCGAGGGTCGCGATATACCTTAGGACACGTCCATA
TCCAAGGGTTTGAGGTTTTGCCAAAACGCCTTATAGAAAAGCAATCCCAA
GTCGGCCCCAATGATCTTTATTGCCCCGATAAAATATGGGATGGGGCTCA
TAAGATCAAACAAACTTATGCAAAGTATGGCTACATCAATACCAATGTAG
ACGTTCTCTTCATCCCTCACGCAACCCGCCCTATTTATGATGTAACTTAT
GAGGTAAGTGAAGGGTCTCCTTATAAAGTTGGGTTAATTAAAATTACTGG
GAATACCCATACAAAATCTGACGTTATTTTACACGAAACCAGTCTCTTCC
CAGGAGATACATTCAATCGCTTAAAGCTAGAAGATACTGAGCAACGTTTA
AGAAATACAGGCTACTTCCAAAGCGTTAGTGTCTATACAGTTCGTTCTCA
ACTTGATCCTATGGGCAATGCGGATCAATACCGAGATATTTTTGTAGAAG
TCAAAGAAACAACAACAGGAAACTTAGGCTTATTCTTAGGATTTAGTTCT
CTTGACAATCTTTTTGGAGGAATTGAACTATCTGAAAGTAATTTTGATCT
ATTTGGAGCTAGAAATATATTTTCTAAAGGTTTTCGTTGTCTAAGAGGCG
GTGGAGAACATCTATTCTTAAAAGCCAACTTCGGGGACAAAGTCACAGAC
TATACTTTGAAGTGGACCAAACCTCATTTTCTAAACACTCCTTGGATTTT
AGGAATTGAATTAGATAAATCAATTAACAGAGCATTATCTAAAGATTATG
CTGTCCAAACCTATGGCGGGAACGTCAGCACAACGTATATCTTGAACGAA
CACCTGAAATACGGTCTATTTTATCGAGGAAGTCAAACGAGTTTACATGA
AAAACGTAAGTTCCTCCTAGGGCCAAATATAGACAGCAATAAAGGATTTG
TCTCTGCTGCAGGTGTCAACTTGAATTACGATTCTGTAGATAGTCCTAGA
ACTCCAACTACAGGGATTCGCGGGGGGGTGACTTTTGAGGTTTCTGGTTT
GGGAGGAACTTATCATTTTACAAAACTCTCTTTAAACAGCTCTATCTATA
GAAAACTTACGCGTAAAGGTATTTTGAAAATCAAAGGGGAAGCTCAATTT
ATTAAACCCTATAGCAATACTACAGCTGAAGGAGTTCCTGTCAGTGAGCG
CTTCTTCCTAGGTGGAGAGACTACAGTTCGGGGATATAAATCCTTTATTA
TCGGTCCAAAATACTCTGCTACAGAACCTCAGGGAGGACTCTCTTCGCTC
CTTATTTCAGAAGAGTTTCAATACCCTCTCATCAGACAACCTAATATTAG
TGCCTTTGTATTCTTAGACTCAGGTTTTGTCGGTTTACAAGAGTATAAGA
TTTCGTTAAAAGATCTACGTAGTAGTGCTGGATTTGGTCTGCGCTTCGAT
GTAATGAATAATGTTCCTGTTATGTTAGGATTTGGTTGGCCCTTCCGTCC
AACCGAGACTTTGAATGGAGAAAAAATTGATGTATCTCAGCGATTCTTCT
TTGCTTTAGGGGGCATGTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy