Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR251 IGR252 IGR248 IGR250 IGR244 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0294 CPn0301 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0294 CPn0301 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0303 CPn0294 CPn0301 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0299

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recR  

Definition:
recombination/repair protein

Gene Start:
336816

Gene Stop:
337418

Gene Length:
603

Molecular Weight*:
22641

pI*:
8.00

Net Charge*:
3.40

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
The RECR protein is thought to play a role in
DNA repair. The E.coli RECR is a zinc-finger protein.

Blast Summary:  PSI-Blast Search
CPn0299 is similar to TP1004 in T. pallidum and UU089 in U. urealyticum, both predicted RecR.

CPn0299 is orthologously related to CT240 and
they share 63% similarity.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0353
COG name: Recombinational DNA repair protein
Functional Class: L
The phylogenetic pattern of COG0353 is -----q-cebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 82 to 175 (E-value = 1.6e-13) place CPn0299 in the Toprim family which is described as Toprim domain (PF01751)

PDB Hit:


Gene Protein Sequence:
MTRYPDYLSKLIFFLRKLPGIGFKTAEKLAFELISWDSEQLKILGNAFHN
VASERSHCPLCFTLKESKEADCHFCREERDNQSLCIVASPKDVFFLERSK
VFKGRYHVLGSLLSPITGKHIENERLSILKSRIETLCPKEIILAIDATLE
GDATALFLKQELQHFSVNISRLALGLPIGLSFDYVDSGTLARAFSGRHSY
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAGATATCCAGATTACTTATCTAAATTAATTTTCTTTTTACGAAA
ACTTCCAGGAATTGGATTTAAAACAGCAGAAAAACTTGCTTTTGAACTCA
TCTCTTGGGACAGCGAACAATTAAAAATATTAGGTAACGCTTTTCATAAT
GTTGCTAGTGAGCGTAGTCACTGTCCCCTATGTTTTACTCTCAAAGAATC
TAAAGAGGCAGACTGTCACTTTTGTAGAGAAGAAAGAGATAACCAAAGTC
TATGTATTGTCGCTTCTCCAAAAGATGTTTTCTTTCTAGAACGTTCTAAA
GTATTCAAGGGACGTTATCATGTTCTTGGTTCACTCTTATCGCCCATTAC
AGGGAAACATATAGAAAACGAGCGTCTCTCCATTTTAAAATCACGCATAG
AAACGCTATGCCCAAAAGAAATTATCCTAGCCATTGATGCAACCTTAGAA
GGAGATGCTACTGCCCTTTTTCTAAAACAAGAATTACAACATTTCTCTGT
AAATATTTCCCGTCTAGCTTTAGGTCTTCCTATAGGCTTATCTTTTGATT
ATGTAGATTCAGGGACACTGGCAAGAGCTTTTTCTGGACGACACTCCTAT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy