Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR251 IGR250 IGR248 IGR244 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 CPn0301 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 CPn0301 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 firA,lpxD, - CPn0302 CPn0300 CPn0293 CPn0301
* Calculated from Protein Sequence

Gene ID: CPn0298

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabH  

Definition:
3-oxyacyl-[acyl-carrier protein] synthase (KAS III or FABH)

Gene Start:
336721

Gene Stop:
335714

Gene Length:
1008

Molecular Weight*:
36068

pI*:
5.50

Net Charge*:
-7.34

EC:
2.3.1.41  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Lipid Metabolism; Fatty acid biosynthesis (path 1)

Comment:
In E. coli, KAS III catalyzes an early condensation reaction in the fatty
acid biosynthesis pathway (acyl-ACP + malonyl-ACP -> 3-oxyacyl-ACP
+ CO2 + ACP).

Blast Summary:  PSI-Blast Search
CPn0298 is orthologously related to CT239, a predicted 3-oxyacyl-[acyl-carrier protein] synthase:
residues 10-335 are 74% similar to CT239. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0332
COG name: 3-oxoacyl-[acyl-carrier-protein] synthase III
Functional Class:  I
The phylogenetic pattern of COG0332 is Amtkyq-ceBRhuj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
168  
228

PDB Hit:


Gene Protein Sequence:
MWFSVNKNKKAAIWATGSYLPEKVLSNADLEKMVDTSDEWIVTRTGIKER
RIAGPQEYTSLMGAIAAEKAIANAGLSKDQIDCIIFSTAAPDYIFPSSGA
LAQAHLGIEDVPTFDCQAACTGYLYGLSVAKAYVESGTYNHVLLIAADKL
SSFVDYTDRNTCVLFGDGGAACVIGESRPGSLEINRLSLGADGKLGELLS
LPAGGSRCPASKETLQSGKHFIAMEGKEVFKHAVRRMETAAKHSIALAGI
QEEDIDWFVPHQANERIIDALAKRFEIDESRVFKSVHKYGNTAASSVGIA
LDELVHTESIKLDDYLLLVAFGGGLSWGAVVLKQV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGTTCTCTGTGAATAAAAACAAAAAAGCAGCAATTTGGGCAACGGG
TTCCTATTTGCCTGAGAAAGTTCTTTCAAACGCAGATTTAGAAAAAATGG
TAGATACCTCTGATGAGTGGATCGTGACCAGAACGGGGATCAAAGAGCGT
CGTATTGCTGGACCTCAGGAGTACACTTCTCTTATGGGAGCCATCGCTGC
AGAGAAAGCTATAGCAAATGCGGGTTTAAGCAAGGATCAGATTGACTGTA
TCATTTTCTCGACAGCAGCACCAGATTATATTTTCCCATCAAGCGGAGCT
CTTGCTCAAGCACATTTAGGCATTGAGGATGTCCCTACATTTGATTGCCA
GGCGGCTTGTACTGGGTATTTGTATGGTTTGTCTGTAGCTAAGGCTTATG
TAGAATCAGGTACATATAACCATGTATTGTTAATTGCTGCTGATAAGTTG
TCTTCTTTTGTAGATTATACAGATCGGAATACCTGTGTGTTGTTTGGAGA
TGGAGGAGCTGCTTGTGTCATAGGGGAGAGTCGGCCAGGATCTTTAGAGA
TTAATAGGTTGTCTTTAGGCGCAGATGGTAAGCTAGGAGAGTTATTAAGC
CTTCCTGCTGGAGGTAGTCGTTGTCCTGCTTCTAAAGAGACTTTACAATC
AGGCAAACATTTTATTGCTATGGAGGGAAAAGAAGTTTTTAAGCATGCTG
TGAGACGTATGGAAACGGCAGCTAAACATTCGATAGCCCTGGCAGGCATT
CAGGAAGAGGATATAGATTGGTTTGTACCTCATCAAGCTAATGAAAGAAT
AATAGATGCTTTAGCGAAGCGTTTTGAGATTGATGAGTCTAGAGTGTTTA
AGAGTGTACATAAGTATGGAAATACTGCGGCCTCGTCTGTGGGCATTGCT
TTGGATGAATTAGTTCATACAGAATCCATTAAGCTTGATGATTATTTACT
TTTAGTTGCCTTTGGGGGCGGTTTGTCTTGGGGCGCAGTAGTTTTAAAGC
AGGTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy