Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR250 IGR248 IGR244 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 CPn0300 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0297

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabD  tfpA  

Definition:
malonyl CoA-acyl carrier protein transacetylase

Gene Start:
335697

Gene Stop:
334771

Gene Length:
927

Molecular Weight*:
33832

pI*:
5.00

Net Charge*:
-8.02

EC:
2.3.1.39  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Comment:
An Xray crystallographic structure is available for this protein,
which is involved in fatty acid biosynthesis.

Blast Summary:  PSI-Blast Search
CPn0297 is orthologous to CT238, a predicted malonyl CoA-acyl carrier protein transacetylase:
residues 4-304 are 60% similar to CT238. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0331
COG name: (acyl-carrier-protein) S-malonyltransferase
Functional Class:  I
The phylogenetic pattern of COG0331 is ----YqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 308 (E-value = 1.6e-11) place CPn0297 in the Acyl_transf_1 family which is described as Acyl transferase domain (PF00698)

PDB Hit:


Gene Protein Sequence:
MKKRYAFLFPGQGSQYVGMGQDLYMEYPEVRELFDFANERLGFSLTSIMF
EGPEDLLMETVHSQLAIYLHSMAVVKVLSQRSSIQPSLVSGLSLGEYTAL
VASDRISVLDGLELVRKRGQLMNEACNQSPGAMAALLGLPSEVIEENITS
LGQGIWIANYNAPKQLVVAGIAEKVDQAIELFRDLGCKKAVRLKVSGAFH
TPLMQVAQDGLAPDIYALCMKDSSLPLVSHVVGKSLVNTEEMRECLARQM
TSPTLWYQSCYHIESEVDEFLELGPGKVLAGLNRSIGISKPITSLGTFAQ
IEKFLSEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACGTTATGCTTTTTTGTTCCCAGGACAAGGGAGCCAATATGT
AGGTATGGGACAAGACCTATATATGGAGTATCCTGAGGTTAGAGAGCTTT
TTGATTTTGCTAATGAAAGGTTAGGATTTTCTCTGACTTCAATTATGTTT
GAAGGTCCTGAGGATCTTTTGATGGAAACAGTACATAGTCAGCTAGCTAT
TTATCTTCATAGCATGGCTGTGGTAAAGGTTCTATCTCAGCGTTCTTCTA
TTCAGCCTTCTTTAGTCTCTGGATTAAGTTTAGGGGAGTATACTGCTTTA
GTTGCTTCCGATAGAATCTCCGTGCTCGACGGCCTTGAGCTTGTTAGAAA
GCGTGGTCAGTTAATGAATGAAGCTTGTAATCAGAGCCCAGGGGCTATGG
CGGCTTTATTAGGGCTTCCCTCTGAAGTTATAGAGGAAAATATAACAAGT
CTTGGTCAAGGAATTTGGATTGCTAATTATAATGCACCCAAACAGCTTGT
AGTGGCTGGAATAGCAGAAAAAGTAGACCAAGCGATTGAGTTATTTCGTG
ATTTAGGATGTAAAAAAGCAGTTCGTTTAAAGGTGTCTGGAGCATTTCAT
ACTCCTTTAATGCAAGTTGCTCAAGATGGCTTAGCTCCAGACATTTATGC
TTTATGCATGAAAGATTCTAGCCTTCCCTTAGTGTCACACGTGGTAGGAA
AATCTTTAGTAAATACTGAAGAAATGCGAGAGTGTTTAGCTCGGCAAATG
ACATCACCTACGTTATGGTATCAGAGTTGTTACCATATCGAATCAGAGGT
GGATGAGTTTTTAGAATTAGGTCCAGGAAAAGTTTTGGCTGGTTTAAATC
GCTCTATAGGGATTTCTAAACCGATTACAAGTCTTGGTACTTTTGCTCAG
ATTGAAAAATTCCTATCAGAGGTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy