Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR248 IGR242 IGR244 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0296

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabG  

Definition:
3-oxyacyl [acyl-carrier protein] reductase

Gene Start:
334765

Gene Stop:
334019

Gene Length:
747

Molecular Weight*:
26490

pI*:
7.90

Net Charge*:
1.58

EC:
1.1.1.100  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Comment:


Blast Summary:  PSI-Blast Search
CPn0296 is orthologous to CT237, a predicted 3-oxyacyl [acyl-carrier protein] reductase:
residues 5-246 are 66% similar to CT237. No similarity to T.pallidum, M.genitalium or
U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1028
COG name: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Functional Class:  R
The phylogenetic pattern of COG1028 is a--KYQVCEBRHUJ----inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae. CPn0296 is weakly similar to CPn0406.

Pfam Summary:  Pfam Search
Residues 10 to 246 (E-value = 3.6e-89) place CPn0296 in the adh_short family which is described as short chain dehydrogenase (PF00106)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
110  
180

PDB Hit:


Gene Protein Sequence:
MDITLVGKKVIVTGGSRGIGLGIVKLFLENGADVEIWGLNEERGQAVIES
LTGLGGEVSFARVDVSHNGGVKDCVQKFLDKHNKIDILVNNAGITRDNLL
MRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIVAKIGS
AGQTNYAAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETDMTSVLNDN
LKAEWLKSIPLGRAGTPEDVARVALFLASQLSSYMTAQTLVVDGGLTY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATATAACATTAGTAGGCAAAAAAGTTATAGTAACTGGAGGATCTCG
AGGAATTGGACTCGGGATAGTTAAGCTTTTTCTTGAGAACGGAGCAGATG
TAGAAATTTGGGGATTGAATGAGGAGCGAGGTCAGGCTGTTATAGAAAGT
TTAACAGGCTTGGGTGGCGAAGTTTCTTTTGCTCGTGTGGATGTGAGTCA
TAATGGTGGAGTGAAAGATTGCGTGCAGAAATTTTTAGATAAGCACAACA
AAATAGATATTTTGGTAAATAATGCAGGCATTACCAGGGATAATTTGTTG
ATGCGTATGTCTGAGGACGACTGGCAATCGGTGATTAGCACCAACTTGAC
TTCCTTGTATTATACATGTTCCTCAGTGATTCGCCATATGATTAAGGCGC
GTTCAGGATCTATTATAAATGTGGCTTCTATTGTTGCTAAGATCGGTAGT
GCGGGCCAGACCAACTATGCTGCTGCTAAAGCTGGGATTATTGCTTTCAC
AAAATCTTTAGCTAAGGAAGTAGCTGCAAGAAATATTCGTGTCAACTGCC
TTGCTCCAGGCTTTATTGAAACAGACATGACAAGCGTGTTGAATGACAAT
TTAAAAGCTGAGTGGCTTAAGTCGATCCCTTTAGGTAGGGCTGGCACTCC
AGAAGATGTTGCTCGTGTGGCGTTGTTTTTAGCCTCGCAGTTATCGAGCT
ATATGACCGCGCAGACACTGGTTGTTGATGGGGGATTGACTTACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy