Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR241 IGR248 IGR242 IGR244 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 recR, - CPn0299 incC, - CPn0292 CPn0300 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0295

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
acpP  

Definition:
acyl carrier protein

Gene Start:
333863

Gene Stop:
333624

Gene Length:
240

Molecular Weight*:
8993

pI*:
3.80

Net Charge*:
-14.00

EC:
 

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0295 is orthologous to CT236, a predicted acyl carrier protein: residues
1-76 are 81% similar to CT236. Weak similarity is seen to TP088.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0236
COG name: Acyl carrier protein
Functional Class:  I
The phylogenetic pattern of COG0236 is ----yqVceBRhUjgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 72 (E-value = 5.5e-17) place CPn0295 in the PP-binding family which is described as Phosphopantetheine attachment site (PF00550)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
29  
65

PDB Hit:


Gene Protein Sequence:
MSLEDDVIAIIVEQLGVDPKEVNENSSFIEDLNADSLDLTELIMTLEEKF
AFEISEEDAEKLRTVGDVFTYIKKRQAEQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTAGAAGATGATGTAATAGCAATTATTGTTGAGCAGTTAGGAGT
GGATCCAAAAGAAGTTAATGAGAACTCTTCTTTTATTGAAGACTTGAATG
CTGATAGTTTAGATTTAACAGAATTGATTATGACTTTAGAAGAAAAATTT
GCTTTTGAAATTTCAGAAGAAGATGCTGAGAAGCTTCGTACTGTCGGGGA
TGTATTTACTTATATTAAGAAACGTCAAGCTGAACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy