Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR241 IGR248 IGR242 IGR244 IGR240 IGR245 IGR249 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 recR, - CPn0299 incC, - CPn0292 CPn0290 CPn0300 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 recR, - CPn0299 incC, - CPn0292 CPn0290 CPn0300 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 recR, - CPn0299 incC, - CPn0292 CPn0290 CPn0300 CPn0293 incB, - CPn0291
* Calculated from Protein Sequence

Gene ID: CPn0294

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
cAMP or cGMP-dependent regulatory subunit type II

Gene Start:
333092

Gene Stop:
333505

Gene Length:
414

Molecular Weight*:
15539

pI*:
5.30

Net Charge*:
-1.10

EC:
2.7.1.37  

Functional Class:
regulatory functions  

Pathway: pathway table

Comment:
In rodents and humans, type II regulatory chains, when activated by
cAMP or cGMP, mediate membrane association through binding to anchoring
proteins.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to eukaryotic cAMP-Dependent Protein Kinase Regulatory Subunit sequences; e.g. residues 10-128 are 29% similar to KAP0_BOVIN; residues 10-128 are 29% similar to KAP0_RAT; residues 10-128 are 29% similar to KAP0_PIG; and residues 9-107 are 32% similar to KAPR_YEAST.
Residues 1-136 are 61% similar to CT235, and residues 36-132 are 29% similar to TP0262. No significant similarity to M.genitalium, U.urealyticum, or M.pneumoniae.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0664
COG name: cAMP-binding domains - Catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases
Functional Class:  T
The phylogenetic pattern of COG0664 is a---YQvCEbRH-----Lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 39-62 and 76-85 represent blocks BL00888B-C (Cyclic nucleotide-binding domain proteins) with a combined E-value of 5.9e-05.

ProDom Summary:  Protein Domain Search
Residues 32-133 are 28% similar to a defined domain of O69644_MYCTU, defined as: PROTEIN KINASE CHANNEL REGULATORY CAMP-BINDING CAMP-DEPENDENT PHOSPHORYLATION CHAIN DUPLICATION IONIC.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 30 to 119 (E-value = 9.4e-17) place CPn0294 in the cNMP_binding family which is described as Cyclic nucleotide-binding domain (PF00027)

PDB Hit:


Gene Protein Sequence:
MNLIDRAFLLKKTIIFQSLDMDLLLTIADKTETIIFKPGSNVFSIGQPGF
SFYIIVEGYITISKEKLESPLNLKPLDCFGEESLFNNKPREYNASANTQV
RMLVLSKGQILNIVEECPSVALSFLELYAKQIKFREP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTGATCGATCGCGCCTTTCTACTAAAAAAAACGATTATATTCCA
ATCTTTAGACATGGACCTTCTTTTAACAATTGCCGATAAAACTGAAACGA
TAATATTTAAGCCTGGCAGCAATGTATTCTCTATAGGACAACCTGGATTC
AGCTTTTATATCATTGTAGAAGGATACATTACGATCTCTAAAGAAAAACT
AGAGTCTCCTCTAAATTTAAAACCTTTAGATTGTTTTGGAGAGGAAAGCT
TATTCAATAATAAGCCCAGGGAATACAATGCTTCTGCAAATACACAAGTC
CGCATGCTAGTTCTTAGCAAAGGACAAATTCTAAACATTGTGGAAGAGTG
CCCATCCGTAGCTTTATCTTTTTTAGAGCTCTATGCTAAACAAATCAAGT
TCAGAGAACCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy