Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR246 IGR247 IGR241 IGR239 IGR242 IGR244 IGR240 IGR245 IGR243 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 Type: tandem, Name:  - 3 acpP, - CPn0295 fabG, - CPn0296 fabD,tfpA, - CPn0297 fabH, - CPn0298 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0293

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
329949

Gene Stop:
332726

Gene Length:
2778

Molecular Weight*:
105612

pI*:
8.50

Net Charge*:
18.79

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0293 is orthologously related to CT234, a Chlamydia-specific hypothetical protein: residues 3-899 are 54% similar to CT234.

CPn0293 is also weakly similar to AF017105, an unknown protein in C. psittaci.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
23  
40
transmembrane  
58  
75
transmembrane  
84  
103
transmembrane  
115  
132
transmembrane  
148  
165
transmembrane  
170  
194
transmembrane  
234  
251
transmembrane  
280  
297
transmembrane  
307  
330
transmembrane  
366  
383
transmembrane  
388  
409
non-globular  
434  
533

PDB Hit:


Gene Protein Sequence:
MQRVLRLLFNLHHGEEKRAFLFFLLGLVWGIGCYGTLSLAEGLFIEKLGS
AELPKIYLGSSLILCVLSSLILYNLFKKHISATALFLIPVSLSILCNFYL
ILSSIFAIDPPRSPLFFYRIVIWSLTILSYTSFWGFVDQFFNLQDGKRHF
CIFNAIIFLGDAIGSGIIASLVHTIGIQGILILFTAALVLTFPIVFYVSK
SLKSLSDDHDLFIDTGHPPPLSKALKLCFYDKYTFYLLCFYFLMQLLAIA
TEFNYLKIFEIQFASKEEFELVAHIGKCSLWISLGNMCFALFAYSRIVKR
LGVNNIILFAPLCFLSLFLFWTFKTTLSIAVLAMVVREGVTYALDDNNLQ
LLIYGVPNKIRNQIRIVVESFIEPIGMLVWSLICFLSSQQYVFCLIISLI
ATILVCLVRSYYAKAILKNLSAQALQLTRSMQDWIKSMTVKQKRQVELFL
LAHLKHPSERHQTFAFQHLLNLASRSVLPSLLAHMNKLSLPNKLKTIEMV
KSSLWAKDFLTLELLKRWTSIFPHPAIASAIHLYFAEHDLLHITHIAEDL
YDTVGDRLLAAILTVRRQEAYGPYRDLADKRLKELLNSDQPEDIVMGLTI
LKLEKNPQNFPILLDFLNTKNEDILIVTCKALHTSVRANHKPYCPELLKR
LRQCSHNDEASQYLLKTISIALDISFVKDLLMTTSQLKNTSRKYAEAMIG
ELDKEVAPAFLQVLTDEGTHNRCRILAAKALCKIDNWLLKKHAYKIVKSK
ASKALFYSYHGHYIQKKYPTYNLSLLANTLNSNYYAEVNFMLSLLGILGS
MEHSGVLIRALTSKNQKIKAQALESLEKNCDSHLFSLLEPFVNQPGMCYS
EKYYFKCGVIPLTLKELLNMMENSPSSLNKLTAQQLKEELSYCDPDFQSV
NTIYNQEHEDFRTEESETLISFLSI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAGAGTTTTGCGACTGCTGTTTAACCTACATCATGGGGAAGAAAA
AAGGGCTTTCCTTTTTTTTCTCTTGGGATTGGTCTGGGGGATAGGTTGTT
ACGGCACTCTCTCTCTAGCTGAAGGCTTATTCATTGAAAAATTAGGATCG
GCAGAATTACCAAAAATTTATTTAGGTTCTTCTCTGATCCTTTGCGTTCT
TTCATCCCTAATTCTTTACAATCTTTTTAAAAAACACATCTCAGCAACAG
CTCTTTTCTTAATTCCTGTTTCTTTATCTATCCTTTGTAATTTTTATCTT
ATTCTCTCTTCTATCTTTGCTATCGATCCCCCCCGGTCTCCTCTGTTTTT
CTATCGGATTGTAATTTGGAGTTTAACGATTCTCTCTTACACGAGTTTTT
GGGGATTTGTAGATCAATTTTTTAATTTACAAGATGGAAAACGACACTTC
TGTATTTTTAATGCTATCATCTTCTTAGGAGATGCTATCGGCAGCGGAAT
CATAGCTAGCCTGGTACACACAATAGGAATCCAGGGCATCCTGATTTTAT
TTACAGCAGCCCTGGTCCTGACATTCCCTATCGTATTCTATGTTTCAAAA
TCTCTAAAGTCGCTTTCCGATGACCATGACCTTTTCATAGATACAGGCCA
CCCACCACCCTTATCAAAAGCATTGAAACTCTGTTTTTATGATAAATATA
CTTTTTATCTGCTTTGCTTTTATTTTCTCATGCAATTGCTAGCGATTGCT
ACAGAGTTTAACTATTTAAAAATCTTTGAAATTCAATTTGCCTCTAAGGA
AGAATTCGAACTCGTCGCACACATAGGAAAGTGTTCCCTGTGGATTTCTT
TAGGAAATATGTGCTTTGCTCTTTTCGCCTACAGTAGAATAGTAAAGCGT
CTTGGAGTCAATAATATCATTTTATTTGCTCCGCTATGTTTCTTAAGCCT
CTTTCTATTTTGGACCTTTAAAACAACCCTAAGCATTGCTGTCCTTGCTA
TGGTAGTACGTGAAGGCGTTACCTACGCTCTTGATGACAACAACCTCCAA
CTACTCATCTATGGAGTCCCCAACAAAATCCGAAACCAAATTCGCATCGT
AGTGGAATCCTTTATAGAACCTATCGGGATGTTGGTCTGGTCCTTAATCT
GTTTCTTGTCTTCTCAACAATATGTGTTCTGCCTAATCATCTCACTAATC
GCCACTATTCTGGTTTGCCTCGTACGCTCTTATTATGCGAAGGCGATTCT
CAAAAATCTATCTGCACAAGCCCTACAACTTACCCGCTCTATGCAAGATT
GGATCAAATCTATGACAGTTAAACAAAAGAGACAAGTCGAACTCTTCTTA
CTTGCTCATCTTAAACACCCCAGTGAGCGTCATCAAACCTTTGCTTTTCA
ACATCTCTTAAATCTAGCAAGCCGCAGTGTCCTTCCAAGCCTCCTTGCCC
ATATGAACAAGCTCAGCCTCCCTAATAAACTCAAGACTATAGAAATGGTA
AAATCTAGCTTATGGGCCAAAGATTTTCTAACCTTAGAGCTCCTGAAACG
TTGGACAAGTATTTTCCCCCATCCTGCCATCGCATCAGCAATACATCTTT
ATTTTGCAGAACACGATCTCCTACATATCACTCATATTGCTGAAGACCTC
TATGATACTGTTGGTGATAGACTTCTTGCCGCAATTCTTACAGTAAGAAG
ACAGGAAGCTTATGGGCCCTATCGAGACCTTGCAGACAAGCGCCTGAAAG
AACTACTCAACTCGGATCAACCTGAAGATATAGTCATGGGGTTGACCATA
CTGAAATTAGAAAAGAATCCACAGAACTTCCCAATTCTTTTAGACTTCTT
GAACACCAAAAACGAAGATATCTTAATTGTCACCTGCAAAGCCCTACACA
CTTCTGTTAGAGCTAATCATAAACCTTATTGCCCCGAACTTCTGAAAAGA
CTACGACAATGCTCGCATAATGATGAAGCAAGTCAATATCTATTAAAAAC
AATTAGCATTGCTTTAGATATCTCATTCGTAAAAGACTTACTGATGACAA
CATCACAACTAAAAAACACCTCTAGAAAATATGCTGAGGCTATGATTGGA
GAGTTGGATAAAGAAGTCGCCCCAGCATTTCTCCAAGTCCTCACCGATGA
GGGAACACACAATCGTTGTCGTATCCTTGCCGCCAAAGCCCTCTGTAAAA
TCGATAATTGGCTGCTGAAAAAACACGCGTATAAAATTGTGAAGTCTAAA
GCAAGTAAGGCTCTGTTCTATTCCTATCACGGCCATTACATTCAAAAGAA
ATACCCCACATACAACCTCAGCTTGCTGGCAAACACATTAAATTCTAATT
ATTATGCAGAAGTAAACTTCATGCTCTCTCTCCTAGGGATTCTTGGTTCC
ATGGAGCACTCTGGTGTACTGATTCGAGCATTAACTAGTAAAAACCAAAA
AATCAAAGCACAAGCACTAGAATCTTTAGAAAAAAACTGCGATAGCCACT
TATTCTCTTTACTAGAACCCTTTGTTAATCAACCAGGCATGTGCTATAGC
GAAAAATACTACTTCAAATGTGGTGTGATTCCTCTAACTCTTAAAGAACT
TTTAAATATGATGGAAAACTCCCCATCATCTTTAAACAAACTAACAGCAC
AGCAACTCAAAGAAGAACTTTCCTATTGCGATCCAGACTTCCAATCTGTA
AATACAATCTATAACCAAGAACATGAAGACTTCAGGACAGAGGAATCAGA
AACCCTAATATCTTTCTTATCTATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy