Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR241 IGR239 IGR238 IGR242 IGR244 IGR240 IGR245 IGR237 IGR243 acpP, - CPn0295 fabG, - CPn0296 CPn0288 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 acpP, - CPn0295 fabG, - CPn0296 CPn0288 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 acpP, - CPn0295 fabG, - CPn0296 CPn0288 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0292

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
incC  

Definition:
inclusion membrane protein C

Gene Start:
329228

Gene Stop:
329839

Gene Length:
612

Molecular Weight*:
21413

pI*:
6.10

Net Charge*:
-2.10

EC:
 

Functional Class:
cell envelope  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0292 is similar to CT233, a predicted inclusion membrane protein C: residues 68-193 are 32% similar to CT233.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
120
transmembrane  
131  
155
transmembrane  
172  
190

PDB Hit:


Gene Protein Sequence:
MTSPIPFQSSGDASFLAEQPQQLPSTSESQLVTQLLTMMKHTQALSETVL
QQQRDRLPTASIILQVGGAPTGGAGAPFQPGPADDHHHPIPPPVVPAQIE
TEITTIRSELQLMRSTLQQSTKGARTGVLVVTAILMTISLLAIIIIILAV
LGFTGVLPQVALLMQGETNLIWAMVSGSIICFIALIGTLGLILTNKNTPL
PAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCTCACCGATCCCCTTTCAGTCTAGTGGCGATGCCTCTTTCCTTGC
CGAGCAGCCACAGCAACTCCCGTCTACTTCTGAATCTCAGCTAGTAACTC
AATTGCTAACCATGATGAAGCATACTCAAGCATTATCCGAAACGGTTCTT
CAACAACAACGCGATCGATTACCAACCGCATCTATTATCCTTCAAGTAGG
AGGAGCTCCTACAGGAGGAGCGGGTGCGCCTTTTCAACCAGGACCGGCAG
ATGATCATCATCATCCCATACCGCCGCCTGTTGTACCAGCTCAAATAGAA
ACAGAAATCACCACTATAAGATCCGAGTTACAGCTCATGCGATCTACTCT
ACAACAAAGCACAAAAGGAGCTCGTACAGGAGTTCTAGTGGTTACTGCAA
TCTTAATGACGATCTCCTTATTGGCTATTATTATCATAATACTAGCTGTG
CTTGGATTTACGGGCGTCTTGCCTCAAGTAGCTTTATTGATGCAGGGTGA
AACAAATCTGATTTGGGCTATGGTGAGCGGTTCTATTATTTGCTTTATTG
CGCTAATTGGAACTCTAGGATTAATTTTAACAAATAAGAACACGCCTCTA
CCGGCTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy