Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR241 IGR239 IGR238 IGR242 IGR244 IGR240 IGR245 IGR237 IGR243 acpP, - CPn0295 CPn0288 CPn0287 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 acpP, - CPn0295 CPn0288 CPn0287 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 acpP, - CPn0295 CPn0288 CPn0287 CPn0294 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0291

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
incB  

Definition:
inclusion membrane protein B

Gene Start:
328667

Gene Stop:
329197

Gene Length:
531

Molecular Weight*:
18099

pI*:
5.20

Net Charge*:
-1.35

EC:
 

Functional Class:
cell envelope  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0291 is similar to CT232, a predicted inclusion membrane protein B (IncB): residues 80-176 are 39% similar to CT232.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
38  
176

PDB Hit:


Gene Protein Sequence:
MSAPIPTPQELSDQITCLNVQYQQVSELARENKGDIEGLKTLTAALTADA
GIQPSADEIYSLQTAAALILSASEKPGSGPSGSTEGSVTVQSPCKFKKVL
AVVLTIIALIAIAVLIACIIAACGGFPLLLSALNLYTIGACVSLPIIAST
SVALICLCTFVANSLIKPVITVRTTR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGCACCTATACCAACCCCACAAGAATTGTCAGACCAAATCACCTG
CTTAAATGTCCAATACCAACAGGTATCCGAACTAGCAAGAGAAAACAAAG
GAGATATTGAAGGCTTAAAAACACTGACTGCGGCTCTAACCGCTGATGCT
GGCATACAGCCTTCAGCTGATGAAATCTACTCATTGCAAACAGCCGCAGC
CCTAATCTTATCTGCTTCCGAAAAACCTGGAAGCGGTCCCTCTGGAAGTA
CTGAAGGATCTGTTACTGTTCAATCTCCATGCAAATTCAAAAAAGTACTA
GCAGTCGTATTAACGATAATTGCTTTAATTGCAATTGCTGTACTTATAGC
TTGTATTATTGCTGCTTGCGGAGGTTTCCCTCTACTTCTATCAGCTCTTA
ACCTATATACCATAGGTGCTTGCGTATCACTACCAATTATAGCTTCAACC
TCGGTTGCGCTTATTTGCTTGTGCACATTTGTAGCAAACTCTCTAATTAA
ACCCGTAATTACTGTCCGTACAACAAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy