Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR241 IGR239 IGR238 IGR242 IGR240 IGR237 IGR243 CPn0288 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0290

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
sodium-dependent transporter

Gene Start:
327042

Gene Stop:
328526

Gene Length:
1485

Molecular Weight*:
54398

pI*:
10.10

Net Charge*:
17.05

EC:
 

Functional Class:
transport and binding proteins; cations  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to sodium-dependent transporter sequences; e.g. residues 1-486 are 65% similar to CT231; residues 8-428 are 23% similar to TP0023; residues 1-368 are 65% similar to (AF017105) sodium-dependent transporter [Chlamydophila caviae]; residues 1-477 are 24% similar to (AE000965) sodium- and chloride-dependent transporter [Archaeoglobus fulgidus]; and residues 5-391 are 26% similar to (U58765) putative sodium/chloride ion channel [Neisseria meningitidis].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0733
COG name: Sodium-dependent transporters (SNF family)
Functional Class:  R
The phylogenetic pattern of COG0733 is am-k-q---B-HUJ---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 13-363 span five regions of similarity to blocks BL00610A-E (Sodium:neurotransmitter symporter family proteins) with a combined E-value of 3.9e-29.

ProDom Summary:  Protein Domain Search
Residues 87-241 are 75% similar to a defined domain of O30781_CHLPS, defined as: TRANSPORT TRANSPORTER NEUROTRANSMITTER TRANSMEMBRANE SYMPORT GLYCOPROTEIN SODIUM-CHLORIDE-DEPENDENT SODIUM-DEPENDENT GABA.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 485 (E-value = 4.4e-11) place CPn0290 in the SNF family which is described as Sodium:neurotransmitter symporter family (PF00209)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
39  
133
non-globular  
214  
494

PDB Hit:


Gene Protein Sequence:
MNKKHASFSSRLGFIFSMIGIAVGAGNIWRFPRVAAQNGGGAFLILWLCF
LFLWSIPLIIIELSIGKLTKKAPIGALIKTAGKKFAWAGGFITLVTTCIL
AYYSTIVGWGLSYFYYAVSGKIHLGNDFAKLWTSHYQSSIPLWAHLTSLG
LAYLVIRKGIVHGIEKCNKILIPAFFLCTIALLLRAVTLPGAVQGIKQLF
SCDKSCFSNYKVWIEALTQNAWDTGAGWGLLLVYAGFASKKTGVVSNGAL
TAICNNLVSLIMGIIIFSTCASLDILGTTQLQDGAGASSIGITFIYLPEL
FTRLPGGIYLTTLFSSIFFLAFSMAALSSMISMLFLLSQTLAEFGIKPYI
SETLATIIAFVLGIPSALSLTFFSNQDTVWGVALIVNGLIFIYAALVYGF
PKLKKEVINAAPGDLRLNKAFDYIIKYLLPIEGILLLGWYFYEGLFPENG
QWWNPISLYSLGSLVLQWSLGLIILWKFNKQLYLRFSRYNHEIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAAAAAACACGCCAGTTTTTCATCTCGACTAGGATTTATATTCTC
TATGATAGGGATTGCCGTTGGGGCAGGAAACATCTGGCGCTTCCCGAGAG
TTGCTGCTCAGAACGGAGGTGGTGCATTCCTAATTCTCTGGCTATGTTTT
TTATTTTTATGGTCCATACCCTTAATTATTATAGAACTCTCTATTGGGAA
ACTAACCAAGAAAGCTCCTATAGGGGCTTTAATTAAAACTGCAGGGAAAA
AATTTGCTTGGGCTGGGGGCTTCATTACCCTTGTTACCACTTGTATACTC
GCCTACTACTCTACAATTGTAGGTTGGGGATTAAGCTACTTTTATTATGC
AGTTTCAGGAAAAATTCACCTGGGAAATGACTTTGCAAAATTATGGACAT
CCCACTATCAGAGTTCTATCCCTCTCTGGGCACACCTCACCTCATTAGGA
TTAGCCTATCTTGTCATTCGTAAAGGCATTGTCCATGGGATTGAAAAATG
TAATAAAATCCTGATCCCCGCATTCTTTCTATGTACCATCGCTCTACTTT
TACGAGCAGTGACTCTTCCAGGAGCCGTTCAAGGAATCAAACAACTCTTT
AGTTGTGATAAAAGTTGCTTTTCAAACTACAAAGTATGGATAGAAGCTCT
TACGCAAAATGCTTGGGATACGGGAGCCGGATGGGGCCTACTGCTTGTGT
ATGCGGGCTTTGCCTCAAAAAAAACGGGAGTAGTGAGCAATGGAGCTCTA
ACAGCTATATGTAATAACCTTGTTTCCTTAATCATGGGGATCATTATCTT
TTCCACATGTGCTTCTTTAGACATTTTAGGAACCACGCAGCTACAAGATG
GAGCAGGAGCTTCAAGCATAGGGATTACCTTTATCTACCTACCAGAGTTA
TTTACCCGTTTGCCTGGAGGAATTTATCTAACCACCCTGTTTAGCTCTAT
TTTCTTCCTAGCATTTTCTATGGCAGCGCTTTCTTCCATGATTTCCATGC
TTTTCCTTCTCTCACAGACTCTTGCAGAATTTGGAATCAAGCCCTACATT
TCTGAAACCCTGGCAACAATCATTGCCTTTGTCCTAGGGATCCCTTCTGC
ACTTAGTCTCACATTTTTCTCTAACCAAGATACCGTTTGGGGAGTTGCAC
TTATTGTAAATGGCTTGATCTTTATTTACGCAGCTTTAGTCTATGGCTTC
CCTAAACTAAAGAAAGAAGTCATTAACGCTGCTCCTGGAGATCTCCGACT
CAACAAAGCCTTTGATTATATAATCAAATATTTACTCCCAATTGAGGGAA
TTCTTCTTTTAGGATGGTATTTCTATGAAGGACTCTTCCCTGAAAATGGT
CAGTGGTGGAATCCTATTTCTCTCTATAGTCTGGGCAGTTTAGTCCTGCA
GTGGTCTTTAGGACTCATAATCTTATGGAAGTTCAATAAACAACTTTATT
TAAGATTTTCCCGTTACAATCACGAAATTCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy