Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR236 IGR241 IGR239 IGR238 IGR242 IGR240 IGR237 CPn0288 mgtE, - CPn0286 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 mgtE, - CPn0286 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 mgtE, - CPn0286 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293
* Calculated from Protein Sequence

Gene ID: CPn0289

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aaaT  

Definition:
glutamate/aspartate transport carrier permease

Gene Start:
325812

Gene Stop:
326999

Gene Length:
1188

Molecular Weight*:
43095

pI*:
8.90

Net Charge*:
9.00

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
In E.coli and B. subtilis, the GLTP protein is an integral membrane protein that governs glutamate and aspartate uptake. The uptake can be inhibited by L-cysteate and beta-hydroxyaspartate.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to amino acid transporters; e.g. residues 9-395 are 57% similar to CT230; residues 15-390 are 25% similar to CT401; residues 130-387 are 24% similar to TP0555; residues 2-295 are 60% similar to (AF017105) amino acid transporter [Chlamydophila caviae]; and residues 33-387 are 27% similar to (AE000735) proton/sodium-glutamate symport protein [Aquifex aeolicus].

COGS Summary:  COGS Search
BeTs to 6 clades of COG1301
COG name: Dicarboxylate permease, Na+ or H+ symporter
Functional Class:  C
The phylogenetic pattern of COG1301 is ---k-q--EBrh----oLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 64-394 span five regions of similarity to blocks BL00713A-F (Sodium:dicarboxylate symporter family proteins) with a combined E-value of 3e-16.

ProDom Summary:  Protein Domain Search
Residues 40-387 are 66% similar to a defined domain of O30780_CHLPS, defined as: TRANSPORTER TRANSPORT TRANSMEMBRANE SYMPORT AMINO ACID EXCITATORY GLYCOPROTEIN SODIUM-DEPENDENT PROTEIN.


Paralogs:  Local Blast Search
CPn0528 is a probable paralog. Residues 15-392 are 26% similar to CPn0528.

Pfam Summary:  Pfam Search
Residues 15 to 394 (E-value = 3.5e-16) place CPn0289 in the SDF family which is described as Sodium:dicarboxylate symporter family (PF00375)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
39
transmembrane  
44  
62
transmembrane  
83  
100
transmembrane  
141  
158
transmembrane  
176  
200
transmembrane  
220  
239
transmembrane  
248  
265
transmembrane  
297  
319
transmembrane  
324  
348
transmembrane  
358  
375

PDB Hit:


Gene Protein Sequence:
MKKQRSHYKKNNLLLLLSILVGLGLGSVQSPWIVYSAECIANTFLKFLRL
LSIPLVFCALGSTITSIQNFNTMVTLGKRILYYTLLTTVIAASIGLLLFF
LLRPQMITQDALATTTKCNPLGYLDVLSDTLPENIFKPFLQGNVISAACL
AVLLGTASLFLQEKEKHFVNQFFNSFFSIFLNLARGGLKLLPIAMLGFSV
ILFKELKDQSNLTMFAEYLLCVIGANLAQGFIVLPILLKINKVSPLKVAK
AMSPALVTAFFSKSSAATLPLTMELAEDDLKINKNLSRFSFPLCSVINMN
GCAAFILITVLFVATSNGMIISPLMSLGWIFIATLAAIGNAGVPMGCYFL
TLSLLTSMNVPLSILGLILPFYTVIDMIETSLNVWSDCCVVSLAN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACAACGCTCTCATTATAAAAAAAATAATCTTTTATTACTTCT
TTCTATATTGGTTGGCCTAGGTTTAGGAAGTGTGCAATCCCCATGGATTG
TTTATTCTGCCGAATGCATAGCAAATACTTTTCTAAAATTCTTACGTTTA
CTTAGCATTCCTTTGGTATTCTGCGCTCTCGGCTCCACCATTACTTCTAT
ACAAAATTTCAATACTATGGTGACTCTAGGAAAAAGAATTTTATATTATA
CCCTGCTGACAACAGTTATCGCTGCTTCCATTGGACTTCTGCTGTTCTTT
TTACTCCGTCCCCAAATGATAACTCAAGATGCCCTAGCCACAACTACAAA
GTGTAATCCCCTAGGATACTTGGATGTCCTTAGCGACACCCTCCCAGAAA
ATATCTTTAAGCCATTCCTCCAAGGAAATGTCATTTCAGCCGCTTGCCTA
GCAGTCCTGCTAGGAACCGCGTCCCTATTTCTTCAAGAAAAAGAAAAACA
TTTCGTAAATCAATTTTTTAATTCATTTTTTTCTATCTTTCTCAACCTGG
CTAGAGGCGGTCTAAAACTTCTCCCAATAGCAATGCTCGGGTTCTCTGTC
ATCTTGTTCAAAGAATTGAAAGATCAAAGCAACCTTACAATGTTTGCCGA
GTATCTGCTTTGCGTTATAGGAGCGAACCTCGCCCAAGGTTTTATTGTTC
TCCCCATACTACTTAAAATAAACAAAGTCTCTCCTTTAAAAGTCGCAAAA
GCAATGTCTCCTGCACTAGTGACAGCTTTTTTCTCAAAATCATCGGCAGC
AACATTACCCCTCACCATGGAACTTGCTGAAGATGATTTAAAAATAAATA
AGAATCTTTCTCGATTTAGCTTCCCGCTATGCTCTGTCATTAACATGAAC
GGGTGCGCTGCTTTTATTCTAATTACTGTTTTGTTTGTTGCGACTTCCAA
TGGTATGATCATTTCGCCTCTAATGTCTTTAGGATGGATTTTTATTGCGA
CTCTCGCAGCTATAGGAAATGCGGGCGTACCCATGGGATGCTACTTTCTT
ACTCTTTCTCTTCTCACATCTATGAATGTTCCTTTATCTATATTAGGTCT
CATCTTACCTTTTTATACTGTAATAGATATGATAGAAACTTCTCTTAATG
TTTGGTCTGATTGCTGCGTAGTCAGTTTAGCAAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy