Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR236 IGR241 IGR239 IGR235 IGR238 IGR242 IGR240 IGR237 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 incB, - CPn0291 incC, - CPn0292 aaaT, - CPn0289 CPn0290 CPn0293 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 incB, - CPn0291 aaaT, - CPn0289 CPn0290 CPn0293 incC, - CPn0292
* Calculated from Protein Sequence

Gene ID: CPn0288

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
325716

Gene Stop:
324568

Gene Length:
1149

Molecular Weight*:
42432

pI*:
9.00

Net Charge*:
12.83

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0288 is orthologously related to CT195, a predicted hypothetical protein. Residues 5-355 are 37% similar to CT195.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
60  
84
transmembrane  
89  
108
transmembrane  
168  
185
transmembrane  
190  
214
transmembrane  
253  
270

PDB Hit:


Gene Protein Sequence:
MSCFNLTSTNESLRPISPKASFPKQGWQSYFRSALRKHRSDTLSVSVCKV
NKYDANLFVRLTVIALAVVGVLILFSIMLASIQGTLVITSWPLVTAAILI
PTILLTGGMYILHRLGKKVDVISGVCIPPFSRRCWVPISSSHTLEKFDEK
HVSACSYLDISTLSADGSGIAAVYQCPPLLFRAFPCFGIPCAMPFVALLR
MIYNLIRFLVVPFYIIFRMIYEHFFCKHLPEDDRFIYKDVAREMGRSLAA
FLKAPFYASACMIGAFYSLLDPLAGRVLMGSVERDWNDNVILARSVSLAN
EAHSLFRFEGGGGRKGLGQHAFYLMLCCQPQSVFLFDKGEIVSGAHPSIQ
LPERRGLDTSGRYPHISVIPDSGNDSAKNFIV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTGTTTTAATCTTACATCTACAAACGAAAGTTTAAGACCAATTAG
TCCTAAGGCATCTTTCCCCAAACAAGGATGGCAAAGCTATTTTCGTTCAG
CATTGCGAAAGCATAGATCTGATACCCTGTCCGTTTCTGTTTGTAAAGTG
AATAAATATGATGCGAACCTTTTTGTGAGGCTCACGGTGATCGCTCTTGC
TGTCGTGGGTGTGTTGATTCTATTCAGTATAATGTTAGCGAGCATACAAG
GTACACTTGTAATTACTTCCTGGCCTTTGGTTACTGCAGCAATTCTTATC
CCAACAATTTTGCTTACTGGAGGCATGTACATTCTGCATCGTCTGGGGAA
GAAAGTAGATGTAATTTCAGGGGTGTGTATTCCACCTTTTAGCAGACGGT
GTTGGGTTCCTATATCCTCCAGCCATACTTTGGAAAAATTCGATGAAAAG
CACGTGAGTGCTTGCTCTTATCTAGATATATCGACGCTGAGTGCTGACGG
TTCTGGAATAGCTGCGGTTTATCAATGTCCACCATTATTATTTCGCGCAT
TCCCTTGTTTTGGAATTCCGTGTGCGATGCCTTTTGTAGCTTTGCTTAGA
ATGATTTACAATTTGATACGCTTTTTAGTGGTTCCATTTTATATCATTTT
CCGAATGATTTACGAGCATTTTTTCTGTAAACATCTTCCCGAAGACGATA
GATTTATTTATAAAGATGTTGCTCGAGAGATGGGGCGGTCTCTTGCTGCT
TTTTTGAAAGCTCCTTTTTATGCTTCTGCATGTATGATAGGAGCTTTTTA
TAGTTTGTTGGACCCTCTTGCAGGCCGTGTATTGATGGGGAGTGTAGAAA
GAGATTGGAATGATAACGTGATACTTGCGCGATCTGTATCTTTAGCCAAT
GAGGCTCATTCCTTATTCCGATTTGAAGGAGGTGGGGGGCGTAAAGGTTT
AGGACAGCATGCTTTTTATTTGATGTTGTGTTGCCAGCCACAATCTGTCT
TCCTTTTTGATAAAGGAGAAATTGTTTCTGGAGCCCATCCCTCAATCCAG
CTCCCTGAGAGACGAGGGCTCGACACTAGTGGTAGATATCCACATATAAG
TGTGATCCCTGATTCGGGGAATGACAGTGCTAAAAATTTTATTGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy