Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR236 IGR239 IGR233 IGR235 IGR238 IGR237 CPn0284 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 aaaT, - CPn0289 CPn0290 CPn0284 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 aaaT, - CPn0289 CPn0290 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 CPn0284 aaaT, - CPn0289 CPn0290
* Calculated from Protein Sequence

Gene ID: CPn0287

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
324221

Gene Stop:
322086

Gene Length:
2136

Molecular Weight*:
81125

pI*:
7.30

Net Charge*:
2.83

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0457
COG name: TPR-repeat-containing proteins
Functional Class:  R
The phylogenetic pattern of COG0457 is AMTKYQVCEB-HUJ--OLINX
Number of proteins in this genome belonging to this COG is 10

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
476  
642

PDB Hit:


Gene Protein Sequence:
MIRSPLPFISSKRALNMLGLQDEFSCPEDVVDFLFSEIELLAQQDEPSEG
YLALSRSLLMMTHNHPKVVKRVIFYGVSYGLKHKSMSIFIDVLTYIDFLF
EKLGISASDRLSLCSARTCINFELYSQTGEMKFLSEVVDNFRLIEQLLKM
HPQLKNRLGWEHFRIGAKQEEVSLVASASVYQAVGRSFIELYHKHLELSD
LACGMKCLALALDLSPNNAHIHADYAKGLVVLGTRQGKSLLIERGMEHFS
KAIFLSFSRDGDTLAYQNYRYSYALASVKLFDLTYKKEHFDQAMNILYQT
VQAFPNLSGLWMVWGELLIRSGWLNSNMKYIEVGLEKLASLQKKTNDPIA
LSGLLATGIAILGLYLEEPNLFKDSRHRLISAMRTFPGNSALVHALGVVQ
LCSALYFNEDSHFASAISCFQSCLEWDLDATGMWQKLFDAYFSWGIKKKS
ARLLRKAVDVASRLCSLRPEAFLFWSDRGLALKCLAEATIDEAYKEIFLS
ESLLHYQRAWDLSGRLEILELWGQSHYLLAELQQSLFHYDEAYTLLTKVD
LTLSSSRVKLILAAVLLGKGRLLQDTDPAEEAREILEPLVEVYLEDENFL
LLLGKVYLFLFWKNKNVCLGKLARTYLEKATSLGCPEAYYTLGKFYAVIK
DVNKAWGMVIRSAQYGVRITEAKWLNDPYLANLREIHAFREVVENQKGRL
WLGNKTEMKRN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAGATCACCATTACCTTTTATTTCCTCTAAAAGAGCCTTAAATAT
GTTGGGCTTGCAGGATGAGTTCAGTTGTCCAGAAGATGTGGTTGATTTCC
TTTTCTCTGAAATTGAATTATTGGCACAACAAGACGAACCGAGCGAGGGC
TACTTAGCTTTGTCTCGGTCTCTATTAATGATGACTCACAATCACCCTAA
AGTTGTAAAGAGAGTGATTTTCTATGGGGTCTCTTATGGTTTAAAACATA
AAAGTATGTCGATTTTCATTGATGTTTTGACCTATATAGATTTTCTTTTT
GAAAAATTAGGAATTAGTGCTTCTGATAGGCTTTCCTTGTGCTCTGCAAG
AACCTGTATCAATTTTGAACTTTATTCTCAGACGGGAGAGATGAAATTTC
TCTCTGAAGTTGTAGATAATTTCCGTTTAATAGAACAGCTTTTGAAAATG
CATCCTCAACTGAAGAATCGTTTAGGATGGGAGCACTTCCGTATAGGAGC
TAAGCAAGAAGAGGTTTCTTTAGTAGCAAGTGCTTCTGTGTATCAGGCTG
TGGGCCGTAGTTTTATAGAATTATACCACAAGCACTTAGAATTGAGTGAT
TTGGCCTGCGGCATGAAATGTCTGGCCTTAGCTCTAGATTTATCACCTAA
TAATGCTCATATCCATGCTGACTATGCTAAGGGCCTGGTAGTTTTAGGAA
CTAGACAGGGAAAGTCTTTGCTCATAGAAAGAGGGATGGAGCATTTTTCT
AAAGCCATTTTTCTGAGTTTCAGCAGGGATGGTGACACCCTTGCCTATCA
AAATTATCGTTATAGCTATGCTCTTGCTTCTGTGAAGTTATTCGATCTGA
CTTATAAAAAAGAGCATTTTGATCAGGCTATGAACATCCTTTACCAAACC
GTTCAGGCGTTTCCTAATCTTTCAGGGCTATGGATGGTTTGGGGTGAGCT
CCTCATTCGTTCGGGATGGTTGAATAGTAATATGAAGTATATTGAAGTTG
GTTTAGAAAAACTGGCTTCTTTACAAAAAAAGACGAATGATCCCATTGCG
CTTTCAGGTTTACTAGCTACAGGGATTGCTATTTTAGGGTTATACTTAGA
AGAACCAAATTTATTTAAAGATAGTCGGCACAGGCTGATTTCTGCTATGA
GGACGTTTCCTGGCAATAGTGCGTTAGTCCATGCTCTTGGTGTTGTGCAG
CTTTGCTCCGCACTTTATTTCAATGAGGACTCGCATTTTGCTTCTGCTAT
TTCTTGTTTTCAGTCTTGTTTAGAATGGGATTTGGATGCGACAGGAATGT
GGCAAAAATTATTTGATGCATATTTTTCTTGGGGGATCAAGAAAAAAAGT
GCTAGATTGCTACGAAAAGCTGTAGATGTAGCAAGTAGGTTATGTTCTTT
GCGTCCAGAGGCTTTTTTATTTTGGAGTGATCGAGGATTAGCATTAAAAT
GCTTGGCAGAAGCCACAATCGATGAAGCTTATAAAGAAATTTTCTTATCA
GAGTCACTGTTACATTATCAGAGAGCGTGGGATTTAAGTGGTCGACTGGA
AATCCTAGAACTTTGGGGACAATCTCATTATTTGCTTGCCGAACTGCAAC
AAAGTTTGTTTCATTATGATGAGGCATACACACTTTTAACTAAGGTAGAT
CTTACTTTATCCTCCTCTAGGGTTAAATTGATTCTTGCTGCGGTTTTGTT
GGGGAAAGGAAGATTACTACAAGATACAGACCCGGCTGAAGAAGCACGGG
AGATTTTAGAACCTCTAGTTGAAGTTTATCTTGAAGATGAGAATTTCTTA
CTACTGTTAGGAAAAGTATACTTATTCCTATTTTGGAAAAATAAGAATGT
GTGTTTAGGTAAGCTTGCTAGAACATATTTAGAGAAGGCAACTTCTTTGG
GGTGTCCAGAGGCGTATTATACTTTGGGAAAGTTTTATGCAGTGATCAAA
GATGTGAACAAGGCGTGGGGAATGGTCATTCGCTCTGCGCAGTATGGCGT
TCGTATTACAGAAGCCAAGTGGTTAAACGATCCTTATTTAGCTAACCTCA
GGGAAATCCATGCATTTCGTGAAGTTGTAGAGAATCAAAAGGGAAGATTA
TGGTTGGGGAACAAAACCGAAATGAAGAGAAACTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy