Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR236 IGR233 IGR235 IGR238 IGR237 CPn0284 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 aaaT, - CPn0289 xasA, - CPn0282 CPn0284 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 aaaT, - CPn0289 xasA, - CPn0282 CPn0284 CPn0283 CPn0288 mgtE, - CPn0286 CPn0285 CPn0287 aaaT, - CPn0289 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0286

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mgtE  

Definition:
Mg++ Transporter (CBS Domain)

Gene Start:
322059

Gene Stop:
320647

Gene Length:
1413

Molecular Weight*:
51729

pI*:
5.10

Net Charge*:
-9.90

EC:
 

Functional Class:
transport and binding proteins; cations  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Mg2+ transporter protein sequences; e.g. residues 1-470 are 97% similar to (AE001613) Mg++ Transporter (CBS Domain) [Chlamydia pneumoniae]; residues 31-461 are 26% similar to (AJ002571) YkoK [Bacillus subtilis]; residues 1-469 are 79% similar to (AE001293) Mg++ Transporter (CBS Domain) [Chlamydia trachomatis]; residues 38-461 are 24% similar to (AE001260) Mg2+ transport protein (mgtE) [Treponema pallidum]; and residues 35-461 are 24% similar to (D90905) Mg2+ transporter [Synechocystis sp.]. BLAST also shows significant similarity to UU009, a predicted magnesium cation transport protein; and no significant similarity to M.genitalium.

COGS Summary:  COGS Search
BeTs to 9 clades of COG2239
COG name: Mg/Co/Ni transporter MgtE (contains CBS domain)
Functional Class:  P
The phylogenetic pattern of COG2239 is --t---vc-br-----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 306-461 are 32% similar, and residues 31-203 are 21% similar to a defined domain of O34442_BACSU, a MG2+ protein transporter.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 143 (E-value = 6.1e-28) place CPn0286 in the MgtE_N family which is described as MgtE intracellular domain (PF03448)
Residues 208 to 261 (E-value = 1.2e-10) place CPn0286 in the CBS family which is described as CBS domain (PF00571)
Residues 327 to 461 (E-value = 2.2e-53) place CPn0286 in the MgtE family which is described as Divalent cation transporter (PF01769)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
63  
80
non-globular  
221  
286
transmembrane  
293  
317
transmembrane  
322  
339
transmembrane  
374  
393
transmembrane  
405  
429
transmembrane  
447  
464

PDB Hit:


Gene Protein Sequence:
MDSRTSHLDDELSFKLEKAFTCLSTDIHSHDLSKIVIEYNPIDLAYAVSC
LPSESRAILYKNLSCITAKVAFIINTDSASRWAIFRRLSDSEVCALIEQM
PPDEAVWVLDDIPDRRYRRILELIDSKKALKIRDLQKHGRNTAGRLMTNE
FFAFLMETTVKDVSACIRSNPGIDLTRLVFVLDFKGELQGVVTDRSLIIN
PPEMSLKQIMNQIEHKVLPDATREEVVDLVERYKIAALPVVDEENFLIGA
ITYEDVVEAIEDIADETIARMAGTTEDVGYQTCHVVQRFLLRAPWLLVTL
FAGLISASVMAYFQKISPALLALIIFFIPLINGMSGNVGVQCSTILVRSM
ATGTLSFGRRRETIFKEMSIGLLTGVVLGILCGLVVYLMGFLGLNIFSGG
GIQLGVTVATGVLGASLTATTLGVLSPFFFAKLGVDPALASGPIVTALND
IMSMIIFFLIAGGINFLFFN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTCCAGGACGAGTCATCTAGATGACGAGCTGAGTTTTAAGTTAGA
AAAAGCATTTACTTGTCTTTCTACAGATATACATTCTCATGATCTTTCTA
AAATTGTGATTGAGTATAACCCGATAGACCTTGCTTATGCTGTTTCCTGT
CTTCCCTCGGAATCGCGTGCTATTTTATATAAGAACCTCTCTTGTATTAC
CGCTAAAGTTGCGTTTATCATCAATACAGATTCTGCTTCGCGGTGGGCGA
TTTTTCGTAGGTTGTCGGATTCTGAGGTCTGCGCTTTAATTGAACAGATG
CCTCCAGATGAAGCGGTATGGGTTTTAGATGATATCCCCGATCGTAGGTA
TCGGAGAATTCTTGAGCTTATAGATTCTAAAAAAGCACTAAAAATTCGTG
ATTTGCAGAAACACGGAAGAAATACTGCAGGAAGGCTAATGACCAATGAG
TTTTTTGCCTTTTTGATGGAAACAACGGTGAAAGACGTTTCTGCTTGTAT
TCGAAGTAATCCTGGGATTGATTTAACTCGTTTGGTCTTTGTTTTGGATT
TTAAAGGCGAGTTGCAAGGTGTCGTTACCGATAGAAGTTTGATCATTAAC
CCTCCCGAGATGTCTTTAAAGCAAATTATGAATCAGATTGAACATAAGGT
GCTTCCTGATGCTACCCGTGAAGAGGTCGTCGATCTTGTAGAGAGGTATA
AAATTGCCGCTCTTCCGGTTGTTGATGAGGAAAATTTCTTGATTGGGGCT
ATTACTTATGAAGATGTTGTTGAAGCTATCGAGGACATCGCTGATGAGAC
TATAGCTAGGATGGCAGGTACTACGGAAGATGTGGGTTATCAGACCTGTC
ATGTTGTGCAAAGATTTTTACTAAGAGCTCCCTGGCTTTTGGTGACTCTA
TTTGCAGGTTTGATTAGCGCCTCCGTCATGGCATATTTCCAAAAAATTTC
CCCCGCCCTTTTAGCTCTGATTATCTTCTTTATTCCTTTGATTAACGGAA
TGTCAGGAAATGTAGGTGTTCAATGTAGCACTATTTTAGTGCGGAGTATG
GCTACAGGGACGCTTTCTTTCGGACGGCGTCGAGAGACCATTTTTAAAGA
AATGAGTATCGGGCTGCTTACAGGAGTCGTTTTAGGGATTCTATGTGGTC
TTGTTGTCTATTTAATGGGCTTTCTAGGCTTAAATATCTTCTCCGGAGGA
GGTATTCAACTAGGCGTTACGGTGGCTACTGGGGTTCTGGGAGCTTCTCT
CACAGCTACGACTCTAGGGGTTTTATCCCCATTTTTCTTTGCTAAGCTAG
GAGTAGACCCGGCTTTAGCCTCCGGGCCCATTGTCACAGCCCTAAATGAT
ATTATGTCAATGATAATCTTTTTTCTGATAGCCGGAGGTATAAACTTTCT
CTTTTTTAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy