Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR230 IGR232 IGR236 IGR233 IGR235 IGR231 CPn0284 CPn0279 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 CPn0287 dhnA, - CPn0281 xasA, - CPn0282 CPn0284 CPn0279 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 CPn0287 dhnA, - CPn0281 xasA, - CPn0282 CPn0284 CPn0279 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 CPn0287 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0283

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
318497

Gene Stop:
317529

Gene Length:
969

Molecular Weight*:
36563

pI*:
5.20

Net Charge*:
-7.91

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
97

PDB Hit:


Gene Protein Sequence:
VKLLIKFAKKDLKNSSIAPLYEVLLEILEAPGEEILEVLFSLDPMWLKSM
LDPKKHSTLGIEISSETAETIESCSLGLISINLLLSGLCLRSSHDRSQAV
KIIQQFCPQFSSEEVQNFVEQRNILTPFLHHLFEGDEVALLNQLSLRLDL
IVPNALYPEPDPSCWQSINSEDCAKDAEDQQEDFNKTKEACKEGLKKLVL
PALSITSIPQLLRARRFKQGAEILMAIDRKKMKQNPFIFLEALLESEEFS
ISVGKYLKLLMPIHLWDKLLHAIYLGYFQTGLICQGEIETFCRRANLNPE
AFQAAIQQGRLLSFLFPKMLLD$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGCTTCTTATAAAATTTGCGAAGAAAGATTTAAAGAATTCCTCAAT
TGCTCCTCTTTATGAAGTTTTACTAGAAATTTTAGAAGCTCCAGGAGAAG
AGATATTAGAAGTATTATTTTCTTTAGATCCTATGTGGTTGAAAAGTATG
CTAGATCCGAAGAAACACTCGACCCTTGGGATCGAAATTTCCAGTGAAAC
AGCTGAAACCATAGAATCTTGTTCTTTGGGCCTGATAAGCATTAATCTCC
TACTTTCAGGGTTGTGTTTACGATCTAGTCATGATAGGTCTCAGGCAGTT
AAGATTATTCAGCAATTTTGTCCCCAATTTTCTTCTGAAGAGGTGCAAAA
TTTTGTAGAACAAAGAAATATATTAACTCCATTTTTACATCATCTGTTTG
AAGGGGACGAAGTCGCCTTGCTAAACCAACTGTCATTAAGGTTGGATTTA
ATAGTACCGAATGCTCTATACCCTGAGCCAGATCCCAGCTGTTGGCAAAG
TATTAATAGTGAGGATTGTGCCAAAGATGCCGAGGATCAGCAAGAAGACT
TCAATAAGACCAAGGAAGCTTGTAAGGAAGGATTGAAAAAACTTGTTCTT
CCTGCGTTGTCTATTACATCGATACCACAGCTTTTGCGAGCTCGACGGTT
CAAACAGGGGGCAGAGATTCTAATGGCTATCGATAGAAAGAAGATGAAAC
AAAACCCATTCATTTTCTTAGAGGCTCTACTGGAATCAGAGGAATTCAGC
ATATCTGTAGGTAAATACCTAAAGTTATTAATGCCTATACATTTATGGGA
TAAGCTTTTACACGCGATATATTTAGGATATTTTCAAACAGGACTTATTT
GTCAAGGAGAGATTGAAACTTTTTGCAGGAGAGCAAATTTGAATCCAGAA
GCTTTCCAGGCTGCCATACAACAAGGAAGGCTTCTTTCTTTTCTTTTCCC
AAAAATGCTTTTAGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy