Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR230 IGR232 IGR233 IGR235 IGR229 IGR231 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 dhnA, - CPn0281 xasA, - CPn0282 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 dhnA, - CPn0281 xasA, - CPn0282 CPn0284 CPn0278 CPn0283 dppF, - CPn0280 mgtE, - CPn0286 CPn0285 CPn0279 CPn0279 CPn0277 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0282

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
xasA  

Definition:
putative amino acid antiporter protein

Gene Start:
316126

Gene Stop:
317532

Gene Length:
1407

Molecular Weight*:
51628

pI*:
10.20

Net Charge*:
17.00

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0282 is similar to CT216, a predicted xasA putative amino acid antiporter protein. Residues 1-466 of CT216 are 76% similar to residues 1-466 of CPn0282 a predicted amino acid
transporter from C. trachomatis.
It is also similar to UU223 xasA a predicted amino acid antiporter from U. urealyticum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0531
COG name: Amino acid transporters
Functional Class:  E
The phylogenetic pattern of COG0531 is AMt-Y--cEBRh--GP--INX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
CPn0282 shows weak similarity to block BL00218, which includes amino acid permeases proteins.

ProDom Summary:  Protein Domain Search
Residues 276-458 are 31% similar to an amino acid transporter domain as seen in O30417_XXXXX.

Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 464 (E-value = 1.5e-05) place CPn0282 in the AA_permease family which is described as Amino acid permease (PF00324)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
32
transmembrane  
40  
58
transmembrane  
84  
108
transmembrane  
124  
148
transmembrane  
153  
177
transmembrane  
191  
209
transmembrane  
234  
252
transmembrane  
277  
294
transmembrane  
335  
352
transmembrane  
357  
379
transmembrane  
403  
421
transmembrane  
440  
457

PDB Hit:


Gene Protein Sequence:
MHSHSKPTKPLGTFTVGMLSLAVVISLRNLPLTAKHGLSTLFFYGLAVIC
FMIPYALISAELASFKPQGIYIWARDALGKWWGFFAIWMQWFHNMTWYPA
VLAFIASTIVYKINPELAHNKVYIATVILAGFWILTFFNFLGITSSALFS
SICVIIGTLIPGVILVSLALFWIFSGNPIAISLSWGNLLPNFSNVSSLVL
LAGMLLALCGLEANANLASDMVNPRKNYPKAVFIGAIATLTILVLGSLSI
AIVIPKEEISLVSGLVKTFTLFFDKYNLSWMTGIVVVMTIAGSLGELNAW
MFAGTKGLFISTQNDCLPRLFKKVNSKNVPTNLMLFQGIVVTIFTLLFLC
LDSADLVYWILTALSVQMYLAMYICLFLAGPILRIKEPRAQRLYSVPGKF
LGICTMSILGILSCAFALWVSFLPPRELAQISEGSKIGYTTFLLLAFSLN
CLIPFGIYFTHKRLSKKS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACTCCCACTCAAAACCAACGAAACCGTTGGGAACATTCACGGTCGG
CATGTTATCACTTGCTGTAGTGATTAGTTTGCGTAATCTCCCGTTAACAG
CAAAACATGGTCTTTCCACTCTGTTTTTTTATGGACTAGCAGTCATATGT
TTTATGATTCCGTATGCTCTGATTTCTGCTGAGCTTGCTTCTTTCAAGCC
TCAGGGAATTTATATTTGGGCACGTGACGCTCTAGGCAAATGGTGGGGAT
TCTTTGCTATATGGATGCAATGGTTTCACAACATGACGTGGTATCCTGCC
GTGTTAGCTTTTATAGCGAGTACCATTGTTTATAAAATCAATCCAGAACT
CGCTCACAACAAAGTGTACATTGCAACCGTGATCCTTGCTGGTTTTTGGA
TACTTACATTTTTTAATTTTTTAGGAATTACTTCTTCCGCATTATTCAGC
TCTATTTGTGTAATCATAGGAACATTAATTCCAGGAGTCATCTTAGTTAG
TTTGGCTCTCTTTTGGATTTTTTCTGGCAATCCCATTGCTATTTCTCTTT
CTTGGGGAAATCTTCTTCCTAATTTCAGTAACGTATCTTCACTTGTACTA
CTAGCTGGAATGTTACTTGCGTTATGTGGTCTAGAGGCTAATGCGAACCT
TGCTTCTGATATGGTAAATCCTAGAAAAAATTATCCAAAGGCAGTCTTCA
TTGGTGCAATAGCAACACTCACTATTTTAGTTCTGGGTTCTTTATCCATA
GCAATAGTGATTCCGAAAGAAGAAATTAGTTTAGTCTCTGGACTAGTAAA
AACGTTTACCTTGTTCTTTGATAAATATAACCTCTCCTGGATGACTGGAA
TCGTTGTAGTCATGACCATTGCAGGATCGCTAGGCGAACTTAATGCTTGG
ATGTTTGCAGGAACAAAGGGGCTTTTTATTTCCACTCAGAATGACTGTCT
TCCCCGACTCTTTAAGAAAGTAAATAGCAAAAATGTTCCAACGAACTTAA
TGTTATTCCAAGGTATTGTTGTGACAATATTCACACTTTTATTTCTATGC
CTTGATTCAGCAGACCTGGTGTATTGGATTTTAACTGCACTGAGCGTGCA
GATGTATCTTGCGATGTACATCTGTCTGTTTCTTGCAGGACCGATCTTAC
GTATCAAAGAACCAAGGGCTCAACGCCTCTATTCTGTACCAGGAAAGTTT
TTGGGAATCTGTACGATGTCTATCTTAGGAATTCTCTCCTGTGCGTTTGC
TCTTTGGGTGAGCTTCCTGCCTCCTAGAGAACTTGCTCAGATATCTGAAG
GCAGCAAAATAGGATATACTACATTCCTGCTTTTAGCATTTAGCTTGAAT
TGCTTAATTCCTTTCGGAATCTATTTCACGCATAAACGCTTATCTAAAAA
GAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy