Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR227 IGR230 IGR232 IGR233 IGR229 IGR228 IGR231 CPn0276 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 dhnA, - CPn0281 xasA, - CPn0282 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 CPn0279 CPn0279 CPn0276 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0281

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dhnA  

Definition:
fructose-bisphosphate aldolase class I (FBPaldolase)

Gene Start:
315057

Gene Stop:
316106

Gene Length:
1050

Molecular Weight*:
38015

pI*:
7.50

Net Charge*:
2.36

EC:
4.1.2.13  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbon fixation Fructose and mannose metabolism Glycolysis / Gluconeogenesis Pentose phosphate cycle

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum.

CPn0281 is orthologously related to CT215:
residues 1-349 are 79% similar to that of CT215.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1830
COG name: DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes
Functional Class:  G
The phylogenetic pattern of COG1830 is AMtk-q--E---------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLNIHDILGNDDENLLSYQCKHITKDKLTLPSHDFVDKVFGLSDRNNRVL
RSLQTMFSHGRLANSGYLSILPVDQGIEHSAGASFAINPIYFDPENIVKL
AIESGCSAVASTYGTLSLLSRKYAHKIPFMLKLNHNELLSYPTKYHQIFF
TQVEAAYSMGAVAVGATVYFGSETSNEEIVAVSNAFAKARSLGLATVLWC
YLRNPAFVANGVDYHTAADLTGQADHLGATLGADIVKQKLPTCQGGFKAI
NFGKTDERVYSELSSNHPIDLCRYQVLNSYCGKVGLINSGGPSGKNDFTE
AARTAVINKRAGGMGLILGRKAFQRPLSEGIQLLNLVQDIYLDPNITIA$


Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGAATATTCATGATATTCTAGGAAATGATGACGAAAACCTATTGTC
ATATCAATGCAAACACATTACAAAAGACAAACTAACTCTTCCCTCTCATG
ATTTTGTAGACAAGGTATTTGGACTCTCTGATAGGAATAATCGTGTTCTC
AGATCCCTACAAACTATGTTTTCTCATGGAAGGTTAGCAAATTCAGGTTA
TCTATCTATACTTCCTGTAGACCAAGGCATAGAGCACTCGGCAGGAGCCT
CTTTTGCTATTAATCCTATATATTTTGATCCAGAAAACATTGTGAAGCTT
GCCATAGAATCTGGATGTAGTGCTGTGGCCTCTACCTATGGAACACTGAG
CTTACTTTCTAGGAAATATGCTCATAAGATTCCCTTTATGCTAAAGCTAA
ACCACAACGAACTCCTCTCCTATCCAACAAAATATCATCAAATTTTCTTT
ACTCAAGTAGAAGCAGCTTATTCAATGGGCGCCGTTGCCGTAGGAGCTAC
TGTTTATTTCGGTTCTGAGACTTCTAATGAAGAAATTGTAGCAGTTTCTA
ATGCATTTGCTAAAGCTCGTTCCCTAGGTCTTGCAACAGTACTTTGGTGC
TATCTACGCAATCCAGCTTTTGTTGCTAATGGAGTAGATTATCATACGGC
AGCAGATCTAACAGGACAGGCTGATCATTTAGGCGCTACCCTAGGAGCCG
ATATTGTGAAACAAAAGCTCCCCACATGCCAGGGAGGATTTAAGGCCATC
AATTTTGGGAAAACAGACGAAAGAGTGTATTCTGAACTCTCTTCAAATCA
TCCCATTGATCTTTGCCGTTATCAAGTCTTAAATAGCTACTGTGGCAAGG
TAGGCCTAATTAACTCGGGAGGACCTTCAGGGAAAAATGATTTTACAGAA
GCGGCTAGAACAGCAGTGATCAACAAAAGAGCAGGGGGAATGGGTCTCAT
TCTTGGAAGAAAAGCTTTCCAACGTCCCCTATCCGAAGGCATCCAATTAT
TAAACCTGGTTCAAGATATCTATTTAGATCCTAATATTACAATCGCTTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy