Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR234 IGR227 IGR230 IGR232 IGR233 IGR229 IGR228 IGR231 CPn0276 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0284 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 CPn0285 gyrB, - CPn0275 CPn0279 CPn0279 CPn0283 CPn0284 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0280

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dppF  

Definition:
dipeptide transporter ATPase

Gene Start:
314572

Gene Stop:
313547

Gene Length:
1026

Molecular Weight*:
38029

pI*:
6.00

Net Charge*:
-6.56

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0280 is similar to many ATPase subunits of ABC transporters in M. genitalium, T. pallidum and U.urealyticum.

CPn0280 is similar to CT689, CT130, CT202, CT152, CT201, CT690, CT653, CT180, CT264, CT416, and CT068. CT689 is a predicted dppF oligopeptide transport ATP-binding protein. Residues 24-268 are 36% similar to CT689.



COGS Summary:  COGS Search
BeTs to 5 clades of COG1135
COG name: Uncharacterized ABC-type transport system ATPase component/cell division protein FtsE
Functional Class: D,R
The phylogenetic pattern of COG1135 is -------cEBrHuj---l-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0280 is similar to CPn0683, CPn0201, CPn0248,CPn0191 and CPn0202. They are all predicted ATPase subunits of ABC transporter proteins.

Pfam Summary:  Pfam Search
Residues 34 to 223 (E-value = 1.2e-62) place CPn0280 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
281  
298

PDB Hit:


Gene Protein Sequence:
VSEQHSPIISVQDVSKKLGDHILLSKVSFSVYPGEVFGIVGHSGSGKTTL
LRCLDFLDMPTSGSISVAGFDNSLPTQKFSRRNFSKKVAYISQNYGLFSS
KTVFENIAYPLRIHHSEMSKSEVEEQVYDTLNFLNLYHRHDAYPGNLSGG
QKQKVAIARAIVCQPEVVLCDEITSALDPKSTENIIERLLQLNQERGITL
VLVSHEIDVVKKICSHVLVMHQGAVEELGTTEELFLNSENSITNELFHED
INIAALSSCYFAEDREEVLRLNFSKELAIQGIISKVIQTGLVSINILSGN
INLFRKSPMGFLIIVLEGEVEQRKKAKELLIELGVVIKEFY$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCAGAACAACATTCTCCTATCATTTCCGTTCAAGATGTTAGTAAGAA
GTTAGGCGACCATATTCTTCTCTCCAAAGTCTCCTTTTCTGTCTATCCTG
GAGAGGTTTTTGGTATAGTTGGTCATAGCGGTTCTGGGAAAACAACGCTT
TTGCGTTGTTTAGACTTTCTTGACATGCCGACATCTGGCTCTATAAGTGT
AGCTGGGTTTGATAACTCTTTGCCAACACAGAAGTTTTCACGTCGTAATT
TTTCTAAAAAAGTTGCCTATATTTCTCAAAATTATGGGTTGTTTTCTTCG
AAAACCGTATTTGAAAACATAGCCTATCCTTTGCGTATTCATCATTCAGA
AATGTCTAAGAGTGAAGTTGAGGAACAGGTATACGATACTCTTAATTTTT
TAAACCTCTATCATAGACATGACGCCTATCCAGGAAATTTAAGTGGTGGT
CAGAAACAAAAAGTTGCCATTGCCAGGGCAATTGTGTGTCAACCTGAAGT
TGTGCTTTGTGATGAGATTACCTCTGCTTTGGATCCTAAATCTACTGAAA
ATATTATTGAAAGGCTGCTTCAATTGAATCAGGAAAGGGGAATTACTTTA
GTTTTAGTGTCGCATGAGATCGATGTAGTAAAAAAAATATGCTCTCATGT
TTTGGTAATGCATCAAGGTGCTGTCGAAGAACTAGGAACTACAGAAGAAC
TTTTTTTAAATTCTGAGAACTCAATTACAAATGAATTGTTCCATGAAGAT
ATAAATATTGCTGCTTTGAGTTCGTGTTATTTTGCAGAAGACAGGGAAGA
AGTTCTTAGATTAAATTTTTCCAAAGAACTCGCTATACAAGGGATCATTA
GTAAGGTGATTCAGACTGGACTGGTCTCTATCAATATTCTTTCCGGCAAC
ATTAATTTATTTAGAAAATCCCCAATGGGATTTCTAATTATTGTTTTGGA
AGGGGAAGTTGAGCAACGTAAAAAAGCAAAAGAGCTTTTAATTGAGCTAG
GCGTCGTTATTAAAGAATTTTATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy