Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR230 IGR226 IGR232 IGR229 IGR228 IGR231 CPn0276 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0277 CPn0278 CPn0283 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0279 CPn0279 CPn0276 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0279

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
ABC transporter permease protein

Gene Start:
313537

Gene Stop:
312872

Gene Length:
666

Molecular Weight*:
24087

pI*:
10.30

Net Charge*:
7.08

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 9-167 are 37% similar to (Z99120) similar to hypothetical proteins [Bacillus subtilis]; residues 1-167 are 35% similar to YAEE_ECOLI, a hypothetical ABC transporter permease; residues 7-165 are 33% similar to (AE000655) ABC transporter, permease protein (yaeE) [Helicobacter pylori 26695]; residues 8-167 are 31% similar to (AE001197), also identified as TP0119, amino acid ABC transporter, permease protein (yaeE) [Treponema pallidum]; residues 14-170 are 25% similar to MP0232, a predicted pstA phosphate transport system permease from M. pneumoniae, and residues 56-167 are 26% similar to (AL049727) probable ABC transport permease [Streptomyces coelicolor].

COGS Summary:  COGS Search
BeTs to 5 clades of COG2011
COG name: Permease component of an uncharacterized ABC transporter
Functional Class:  R
The phylogenetic pattern of COG2011 is --------eb-huj---l-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 58-140 span 5 regions of similarity to blocks BL00402A,B (Binding-protein-dependent transport systems, inner membrane component).

ProDom Summary:  Protein Domain Search
Residues 16-104 are 46% similar to a transport permease domain of YAEE_ECOLI. Residues 56-110 are 49% similar to a defined domain of YAEE_HAEIN, an ABC transporter. Residues 16-75 are 41% similar, and residues 111-171 are 34% similar to a defined domain of O32168_BACSU, an ABC transporter.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 220 (E-value = 1.8e-05) place CPn0279 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
37
transmembrane  
56  
80
transmembrane  
92  
109
transmembrane  
119  
137
transmembrane  
142  
162
transmembrane  
188  
205

PDB Hit:


Gene Protein Sequence:
MQSDLIQILLKETVNTLYMVSTAFFFSCAIGGMLGLGLFCTSPKSLNPKK
SLYATISMILSFLTAIPFAILIVILFPITRWIVGTSLGPTASIVPLTIGA
IPFVVTIVVDAFRNSALNYLESAVALGIPKRNILFGILLPESYPQLIFSL
KSLVVHLISCSTLAGFVGGGGLGQLLLQYGYYRFEWSVTTSVLVITLVLI
ESVRILGDFWGRRVLKYRGIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATCCGATCTTATTCAGATTTTATTAAAAGAAACAGTCAATACACT
TTATATGGTGTCGACTGCTTTTTTCTTCTCTTGTGCTATTGGAGGGATGC
TAGGTTTGGGGCTTTTCTGCACGTCGCCTAAGAGTCTTAATCCTAAGAAA
AGCCTTTACGCAACAATCTCAATGATTCTAAGTTTTCTTACCGCGATTCC
ATTTGCGATTCTTATTGTTATTCTTTTTCCGATCACGCGATGGATTGTAG
GGACTTCTTTAGGCCCTACGGCTTCTATTGTTCCTCTCACTATCGGAGCC
ATTCCTTTTGTTGTTACTATAGTGGTTGATGCTTTTCGTAATTCAGCCCT
TAACTATCTTGAATCTGCCGTTGCTTTGGGAATTCCTAAAAGGAATATTC
TTTTTGGTATACTTCTACCTGAAAGCTATCCACAGCTCATATTTTCTCTT
AAGTCTCTTGTTGTTCATCTCATTTCATGTTCGACTCTTGCAGGATTTGT
TGGAGGCGGAGGGCTAGGACAGTTATTATTGCAGTATGGTTACTACCGTT
TTGAATGGTCTGTCACAACATCAGTACTTGTCATCACTTTAGTTCTTATC
GAGTCAGTGCGTATTCTAGGAGATTTCTGGGGGCGTCGTGTATTAAAGTA
TAGAGGGATTCTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy