Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR230 IGR226 IGR232 IGR229 IGR228 IGR231 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0279 CPn0279 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0278

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
outer membrane lipoprotein

Gene Start:
312875

Gene Stop:
312057

Gene Length:
819

Molecular Weight*:
30251

pI*:
7.70

Net Charge*:
2.60

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18427.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to outer membrane protein sequences; e.g. residues 19-265 are 38% similar to (AE000654) outer membrane protein [Helicobacter pylori 26695]; residues 6-265 are 37% similar to (AE001569) putative outer membrane protein [Helicobacter pylori J99]; residues 6-269 are 32% similar to (Z99120) similar to hypothetical proteins [Bacillus subtilis]; residues 8-262 are 31% similar to YAEC_ECOLI, a hypothetical lipoprotein; and residues 2-252 are 32% similar to (L16627) lipoprotein 2 [Pasteurella haemolytica]. BLAST also reveals residues 35-262 are 32% similar to TP0821, a 29 kD hypothetical lipoprotein.
No significant similarity to C.trachomatis, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1464
COG name: Lipoprotein, attached to the cytoplasmic membrane
Functional Class: M
The phylogenetic pattern of COG1464 is --------EB-huj---l-n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 68-104, 141-179, and 213-263 represent blocks DM01922B-D (lipoprotein-28.)

ProDom Summary:  Protein Domain Search
Residues 26-265 are 40% similar to a lipoprotein membrane domain of O26084_XXXXX.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 27 to 268 (E-value = 2.9e-109) place CPn0278 in the Lipoprotein_9 family which is described as NLPA lipoprotein (PF03180)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23

PDB Hit:


Gene Protein Sequence:
MKKKLSLLVGLIFVLSSCHKEDAQNKIRIVASPTPHAELLESLQEEAKDL
GIKLKILPVDDYRIPNRLLLDKQVDANYFQHQAFLDDECERYDCKGELVV
IAKVHLEPQAIYSKKHSSLERLKSQKKLTIAIPVDRTNAQRALHLLEECG
LIVCKGPANLNMTAKDVCGKENRSINILEVSAPLLVGSLPDVDAAVIPGN
FAIAANLSPKKDSLCLEDLSVSKYTNLVVIRSEDVGSPKMIKLQKLFQSP
SVQHFFDTKYHGNILTMTQDNG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAAAATTATCATTACTTGTAGGTTTAATTTTTGTTTTGAGTTC
TTGCCATAAGGAAGATGCTCAGAATAAAATACGTATTGTAGCCAGTCCGA
CACCTCATGCGGAATTATTGGAGAGTTTACAGGAAGAGGCTAAAGATCTT
GGAATCAAGCTGAAAATACTTCCAGTAGATGATTATCGTATTCCTAATCG
TTTGCTTTTGGATAAACAAGTAGATGCAAATTACTTTCAACATCAAGCTT
TTCTTGATGACGAATGCGAGCGTTATGATTGTAAGGGTGAATTAGTTGTT
ATCGCTAAAGTTCATTTGGAACCTCAAGCAATTTATTCTAAGAAACATTC
TTCTTTAGAGCGCTTAAAAAGCCAGAAGAAACTGACTATAGCGATTCCTG
TGGATCGTACGAATGCTCAGCGTGCTCTACACTTGTTAGAAGAGTGCGGA
CTCATTGTTTGCAAAGGGCCTGCTAATTTAAATATGACAGCTAAAGATGT
CTGTGGGAAAGAAAATAGAAGTATCAACATATTAGAGGTGTCAGCTCCTC
TTCTTGTCGGATCTCTTCCTGACGTTGATGCTGCTGTCATTCCTGGAAAT
TTTGCTATAGCAGCAAACCTTTCTCCAAAGAAAGATAGTCTTTGTTTAGA
GGATCTTTCGGTATCTAAGTATACAAACCTTGTTGTCATTCGTTCTGAAG
ACGTAGGTTCTCCTAAAATGATAAAATTACAGAAGCTGTTTCAATCTCCT
TCTGTACAACATTTTTTTGATACAAAATATCATGGGAATATTTTGACAAT
GACTCAAGACAATGGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy