Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR230 IGR226 IGR232 IGR229 IGR228 IGR231 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 xasA, - CPn0282 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0279 CPn0279 CPn0276 dhnA, - CPn0281 xasA, - CPn0282
* Calculated from Protein Sequence

Gene ID: CPn0277

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
311910

Gene Stop:
311401

Gene Length:
510

Molecular Weight*:
18188

pI*:
5.80

Net Charge*:
-1.86

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarities to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
73  
169

PDB Hit:


Gene Protein Sequence:
MIINVRAPAFGITSVQQFSTNFQAAIPILNIVIGCSRISSTYAEDIEEVA
QEKLEKSTHSKSSTSVNLWAHRVRGVVEILGGGIVILALEITALVLQVII
KLIKCLIDVLCVCLFGLGVCVVAIIGAIAFCVVVVVKYLGFCSQGEELEP
IEVKTLISPDKPYPTVVYV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAATTAATGTTAGAGCCCCAGCTTTTGGTATTACTTCTGTTCAGCA
GTTTTCAACTAATTTCCAAGCTGCTATTCCTATTTTGAATATAGTTATAG
GTTGTTCTAGAATTAGTAGCACTTATGCTGAGGATATAGAGGAAGTTGCG
CAGGAAAAATTAGAGAAATCAACACATAGTAAATCCTCAACTTCTGTAAA
TCTTTGGGCACATCGGGTTCGTGGAGTTGTAGAGATTCTCGGCGGAGGGA
TCGTTATACTAGCGTTAGAAATCACAGCCTTAGTGCTCCAAGTAATCATT
AAATTAATAAAATGCCTCATAGATGTTCTATGCGTTTGCTTGTTTGGCCT
TGGAGTTTGTGTAGTCGCTATTATAGGAGCGATTGCATTCTGCGTGGTGG
TGGTTGTAAAGTACCTAGGTTTTTGCTCTCAAGGTGAAGAGCTAGAGCCT
ATAGAGGTGAAGACTCTTATTTCTCCAGATAAGCCTTATCCTACCGTTGT
ATATGTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy