Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR230 IGR226 IGR229 IGR228 IGR231 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 dhnA, - CPn0281 CPn0276 CPn0277 CPn0278 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0279 CPn0279 dhnA, - CPn0281
* Calculated from Protein Sequence

Gene ID: CPn0276

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
311137

Gene Stop:
310790

Gene Length:
348

Molecular Weight*:
13419

pI*:
11.00

Net Charge*:
12.42

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0276 is orthologously related to CT191, a hypothetical protein: residues 17-115 are 50% similar to CT191.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MFLKRKKRGGSQVQNKRTASPIKHAKHYLHNYLQELQKIMAARPHDAIDA
WNQVFRDKYKGMSQAIGFRDHILLVKVYNSSLYALLKQTPQNDLIMSLYQ
VASHVQIREIQFLLG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCTTAAAGCGAAAAAAAAGGGGAGGATCTCAAGTTCAAAATAAAAG
AACAGCTTCCCCTATAAAACACGCTAAACACTATCTCCATAATTATTTGC
AGGAACTTCAAAAAATTATGGCAGCTAGGCCTCATGACGCTATTGACGCT
TGGAATCAGGTTTTTAGAGACAAATATAAAGGGATGTCTCAAGCTATAGG
GTTCAGAGATCATATTTTGTTAGTAAAAGTTTACAATTCCTCGTTATATG
CTTTGTTAAAACAGACGCCTCAAAATGATTTAATTATGAGTTTGTATCAG
GTGGCTTCTCACGTGCAGATTAGGGAAATACAGTTTTTGTTAGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy