Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR225 IGR230 IGR226 IGR229 IGR228 IGR231 CPn0276 CPn0277 CPn0278 dnaX,dnaZ, - CPn0272 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0276 CPn0277 CPn0278 dnaX,dnaZ, - CPn0272 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 CPn0276 CPn0277 CPn0278 dnaX,dnaZ, - CPn0272 dppF, - CPn0280 gyrB, - CPn0275 gyrA, - CPn0274 tdk, - CPn0273 CPn0279 tdk, - CPn0273 CPn0279
* Calculated from Protein Sequence

Gene ID: CPn0275

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrB  

Definition:
DNA gyrase subunit B (topoisomerase)

Gene Start:
310786

Gene Stop:
308369

Gene Length:
2418

Molecular Weight*:
90566

pI*:
5.20

Net Charge*:
-18.28

EC:
5.99.1.3  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
The B chain of DNA gyrase is said to perform an
ATP hydrolyzing function. Two A chains (CPn0274) and two B chains make up
the complete gyrase molecule.See CPn0274.
Just as CPn0274 is paralogously related to CPn0716,
CPn0275 is paralogously related to CPn0715, another gyrase B
subunit gene.

Blast Summary:  PSI-Blast Search
CPn0275 is similar to TP1006 in T. pallidum, UU081 and UU466 in U. urealyticum, MG003 and MG203. They are all predicted DNA gyrase subunit B.

CPn0275 is orthologously related to CT190, a predicted DNA gyrase subunit B: residues 1-805 are 81% similar to CPn0275. CPn0275 is also similar to CT661, a predicted DNA gyrase subunit B.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0187
COG name: DNA gyrase (topoisomerase II) B subunit
Functional Class:  L
The phylogenetic pattern of COG0187 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0275 is paralogously related to CPn0715, a predicted DNA gyrase subunit B: residues 8-579 and 716-797 are 30% and 28% similar, respectively, to CPn0715.

Pfam Summary:  Pfam Search
Residues 33 to 182 (E-value = 5.1e-27) place CPn0275 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 230 to 404 (E-value = 2e-87) place CPn0275 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 461 to 543 (E-value = 4.8e-09) place CPn0275 in the Toprim family which is described as Toprim domain (PF01751)
Residues 726 to 792 (E-value = 3.7e-45) place CPn0275 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

PDB Hit:


Gene Protein Sequence:
MDPKEKNYDASAITVLEGLQAVRERPGMYIGDTGITGLHHLVYEVVDNSI
DEAMAGYCSRIDVRILEDGGIVIVDNGRGIPIEVHERESAKQGREVSALE
VVLTVLHAGGKFDKDSYKVSGGLHGVGVSCVNALSEKLVATVFKDKKCYQ
MEFSRGIPVTPLQYVSVSDRQGTEIVFYPDPKIFSTCTFDRSILMKRLRE
LAFLNRGITIVFEDDRDVSFDKVTFFYEGGIQSFVSYLNQNKESLFSEPI
YICGTRVGDDGEIEFEAALQWNSGYSELVYSYANNIPTRQGGTHLTGFST
ALTRVINTYIKAHNLAKNNKLALTGEDIREGLTAVISVKVPNPQFEGQTK
QKLGNSDVSSVAQQVVGEALTIFFEENPQIARMIVDKVFVAAQAREAAKK
ARELTLRKSALDSARLPGKLIDCLEKDPEKCEMYIVEGDSAGGSAKQGRD
RRFQAILPIRGKILNVEKARLQKIFQNQEIGTIIAALGCGIGADNFNLSK
LRYRRIIIMTDADVDGSHIRTLLLTFFYRHMTALIENECVYIAQPPLYKV
SKKKDFRYILSEKEMDSYLLMLGTNESSILFKSTERELRGEALESFINVI
LDVESFINTLEKKAIPFSEFLEMYKEGIGYPLYYLAPATGMQGGRYLYSD
EEKEEALAQEETHKFKIIELYKVAVFVDIQNQLKEYGLDISSYLIPQKNE
IVIGNEDSPSCNYSCYTLEEVINYLKNLGRKGIEIQRYKGLGEMNADQLW
DTTMNPEQRTLIHVSLKDAVEADHIFTMLMGEEVPPRREFIESHALSIRI
NNLDI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACCCAAAAGAAAAAAATTACGATGCATCCGCTATTACTGTTTTAGA
AGGGCTACAAGCTGTTCGTGAGCGCCCCGGGATGTACATTGGAGATACGG
GAATCACGGGTCTTCATCATCTAGTCTATGAGGTTGTAGACAACAGCATT
GACGAAGCCATGGCAGGTTATTGCTCTAGGATTGATGTTCGCATTTTAGA
GGACGGGGGTATTGTCATCGTAGATAATGGCCGAGGAATCCCTATAGAAG
TTCACGAAAGAGAGTCTGCAAAACAAGGTAGAGAGGTCTCTGCTTTAGAA
GTGGTTTTAACAGTCCTTCATGCTGGAGGAAAATTCGATAAGGATAGCTA
TAAAGTATCCGGAGGCTTGCACGGAGTTGGGGTTTCTTGCGTTAATGCTC
TTTCGGAGAAATTAGTTGCCACGGTCTTTAAAGATAAGAAGTGTTATCAA
ATGGAGTTCTCTAGGGGAATTCCTGTAACTCCATTGCAGTATGTAAGTGT
TAGTGATCGGCAGGGAACAGAAATCGTTTTCTACCCTGATCCTAAAATAT
TTTCGACTTGTACTTTTGATCGCTCTATTTTAATGAAACGCTTGCGAGAG
CTTGCTTTCTTAAATCGTGGGATCACAATAGTCTTTGAAGATGATCGAGA
TGTTAGCTTTGACAAGGTTACCTTCTTTTATGAGGGAGGGATTCAATCTT
TTGTAAGTTACCTGAATCAAAATAAAGAAAGCCTTTTCTCTGAACCGATT
TATATTTGTGGAACTCGAGTAGGAGATGATGGAGAAATCGAGTTTGAAGC
AGCCTTACAATGGAATTCAGGGTATTCTGAACTTGTTTATTCCTATGCCA
ATAATATTCCTACACGCCAAGGAGGAACGCATCTTACAGGGTTTTCTACC
GCGCTTACTAGGGTAATCAATACGTATATTAAAGCTCATAACCTTGCGAA
GAATAATAAGCTTGCATTAACCGGAGAAGATATTCGAGAAGGTCTGACAG
CTGTGATTTCTGTAAAGGTCCCAAATCCACAATTTGAAGGGCAAACAAAA
CAGAAATTAGGAAACAGTGATGTTAGCTCAGTGGCTCAACAGGTTGTAGG
GGAAGCTCTGACAATCTTTTTTGAAGAGAATCCTCAAATTGCTAGGATGA
TTGTTGATAAGGTTTTTGTTGCAGCGCAAGCTAGAGAAGCTGCAAAAAAA
GCTCGAGAATTGACTTTAAGGAAAAGTGCTTTAGATAGCGCACGCTTACC
TGGAAAACTAATTGATTGTTTAGAAAAAGATCCCGAAAAGTGTGAGATGT
ACATTGTGGAGGGGGATTCTGCTGGAGGATCTGCGAAACAAGGTAGAGAT
CGAAGATTTCAAGCAATTCTGCCTATTCGAGGTAAAATTCTGAACGTAGA
AAAAGCTCGTCTACAGAAAATTTTCCAAAACCAAGAGATAGGAACCATCA
TAGCAGCTTTAGGCTGTGGCATAGGTGCTGATAATTTTAATCTCAGTAAA
TTACGCTATAGACGTATCATTATCATGACAGATGCTGACGTGGACGGTTC
TCATATTCGTACCCTACTTCTCACATTCTTCTATCGTCATATGACAGCGC
TTATTGAAAATGAATGTGTTTATATTGCTCAACCTCCTTTATACAAGGTG
AGTAAGAAAAAAGACTTCCGTTATATTCTTTCAGAGAAAGAAATGGACAG
CTATTTGCTCATGTTAGGCACGAATGAGAGCTCCATTCTCTTTAAATCTA
CGGAAAGAGAATTACGTGGAGAGGCTTTAGAGAGTTTTATCAACGTCATT
TTAGATGTAGAGAGCTTTATAAACACTCTTGAGAAAAAAGCGATTCCCTT
CTCTGAATTTTTAGAGATGTATAAAGAGGGGATAGGCTATCCTTTGTACT
ATCTTGCTCCGGCAACTGGAATGCAGGGAGGGCGCTATCTTTATTCTGAT
GAGGAAAAAGAAGAAGCTTTAGCTCAAGAAGAAACTCATAAGTTTAAAAT
CATAGAGCTTTATAAAGTTGCTGTGTTCGTAGATATTCAAAATCAACTCA
AAGAATATGGTTTAGATATTTCTAGCTATCTTATCCCTCAGAAAAACGAG
ATTGTGATTGGAAATGAAGATTCCCCAAGCTGTAACTATAGCTGCTATAC
CTTGGAAGAAGTCATTAACTATCTTAAAAATCTTGGAAGAAAAGGCATAG
AAATTCAGAGGTATAAAGGTCTTGGAGAGATGAATGCCGACCAGCTTTGG
GATACTACTATGAATCCTGAGCAGAGAACACTCATTCATGTGTCATTGAA
GGATGCCGTAGAAGCAGACCATATTTTCACTATGTTGATGGGGGAAGAAG
TCCCTCCAAGAAGAGAATTCATAGAAAGTCATGCTTTGTCCATTAGGATA
AATAATTTAGATATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy